Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Plasmodium falciparum VAR2CSA DBL5

Recombinant Plasmodium falciparum VAR2CSA DBL5 is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Baculovirus. Endotoxin Level: Not Tested. Species: Plasmodium falciparum. Target Name: Plasmodium falciparum VAR2CSA DBL5. Accession Number: ACM48350.1. Expression Region: 1~353aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 45.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Plasmodium falciparum VAR2CSA DBL5 is a purified Recombinant Protein.

Accession Number

ACM48350.1

Expression Region

1~353aa

Host

Baculovirus

Target

Plasmodium falciparum VAR2CSA DBL5

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

45.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Species

Plasmodium falciparum

Protein Name

Recombinant Protein

AA Sequence

RCFDDQTKMKVCDLIGDAIGCKDKTKLDELDEWNDMDLRDPYNKYKGVLIPPRRRQLCFSRIVRGPANLRNLNEFKEEILKGAQSEGKFLGNYYNEDKDKEKKEDRKEKALEAMKNSFYDYEYIIKGSDILENIQFKDIKRKLDKLLTKETNNNTKKAEDWWETNKKSIWNAMLCGYKKSGNKIIDPSWCTIPTTEKTPQFLRWIKEWGTNVCIQKEKYKEYVKSECSNVPNNNLGSQASESTKCTSEIRKYQEWSRKRSIQWEAISERYKKYKGMDEFKNVFNNANEPDANEYLKEHCSKCPCGFNDMEEITKYTNIGNEAFNTIIEKVKIPAELEDVIYRLKHHEYNSNDY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human DLL4 (Delta-like protein 4) ELISA Kit
MBS7606698-01 48 Well

Human DLL4 (Delta-like protein 4) ELISA Kit

Sign In for Pricing
View Details
Human DLL4 (Delta-like protein 4) ELISA Kit
MBS7606698-02 96 Well

Human DLL4 (Delta-like protein 4) ELISA Kit

Sign In for Pricing
View Details
Human DLL4 (Delta-like protein 4) ELISA Kit
MBS7606698-03 5x 96 Well

Human DLL4 (Delta-like protein 4) ELISA Kit

Sign In for Pricing
View Details
Human DLL4 (Delta-like protein 4) ELISA Kit
MBS7606698-04 10x 96 Well

Human DLL4 (Delta-like protein 4) ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal SATB1 Antibody (OTI13D6) - Azide and BSA Free
NBP2-73991 100 µg

Mouse Monoclonal SATB1 Antibody (OTI13D6) - Azide and BSA Free

Sign In for Pricing
View Details
TAS2R46 (NM_176887) Human Over-expression Lysate
LY406141 100 µg

TAS2R46 (NM_176887) Human Over-expression Lysate

Sign In for Pricing
View Details