Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rabbit Tissue factor pathway inhibitor (TFPI)

Recombinant Rabbit Tissue factor pathway inhibitor (TFPI) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Baculovirus. Endotoxin Level: Not Tested. Species: Rabbit (Oryctolagus cuniculus) . Target Name: TFPI. Target Synonyms: Extrinsic pathway inhibitor (EPI; Lipoprotein-associated coagulation inhibitor; LACI) . Accession Number: P19761. Expression Region: 25~300aa. Tag Info: N-Terminal 10Xhis-Tagged. Theoretical MW: 34.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Rabbit Tissue factor pathway inhibitor (TFPI) is a purified Recombinant Protein.

Accession Number

P19761

Expression Region

25~300aa

Host

Baculovirus

Target

TFPI

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

34.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Extrinsic pathway inhibitor (EPI; Lipoprotein-associated coagulation inhibitor; LACI)

Species

Rabbit (Oryctolagus cuniculus)

Protein Name

Recombinant Protein

AA Sequence

AAEEDEEFTNITDIKPPLQKPTHSFCAMKVDDGPCRAYIKRFFFNILTHQCEEFIYGGCEGNENRFESLEECKEKCARDYPKMTTKLTFQKGKPDFCFLEEDPGICRGYITRYFYNNQSKQCERFKYGGCLGNLNNFESLEECKNTCENPTSDFQVDDHRTQLNTVNNTLINQPTKAPRRWAFHGPSWCLPPADRGLCQANEIRFFYNAIIGKCRPFKYSGCGGNENNFTSKKACITACKKGFIPKSIKGGLIKTKRKKKKQPVKITYVETFVKKT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPLP1P13 Protein Lysate (Human) with C-Ha Tag
41979031 100 µg

RPLP1P13 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
MARCH8 Rabbit Polyclonal Antibody (PerCP)
orb2377250 100 µL

MARCH8 Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details
Mouse Egln2 activation kit by CRISPRa
GA212389 1 Kit

Mouse Egln2 activation kit by CRISPRa

Sign In for Pricing
View Details
Rpap3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K7446807 1.0 µg DNA

Rpap3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
ITSN2 Antibody
47805 100 µL

ITSN2 Antibody

Sign In for Pricing
View Details
Anti-HCN1 Antibody Picoband® Fluoro647 Conjugated
PB9210-Fluoro647 100 µg/Vial

Anti-HCN1 Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details