Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rabbit Tissue factor pathway inhibitor (TFPI)

Recombinant Rabbit Tissue factor pathway inhibitor (TFPI) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Baculovirus. Endotoxin Level: Not Tested. Species: Rabbit (Oryctolagus cuniculus) . Target Name: TFPI. Target Synonyms: Extrinsic pathway inhibitor (EPI; Lipoprotein-associated coagulation inhibitor; LACI) . Accession Number: P19761. Expression Region: 25~300aa. Tag Info: N-Terminal 10Xhis-Tagged. Theoretical MW: 34.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Rabbit Tissue factor pathway inhibitor (TFPI) is a purified Recombinant Protein.

Accession Number

P19761

Expression Region

25~300aa

Host

Baculovirus

Target

TFPI

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

34.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Extrinsic pathway inhibitor (EPI; Lipoprotein-associated coagulation inhibitor; LACI)

Species

Rabbit (Oryctolagus cuniculus)

Protein Name

Recombinant Protein

AA Sequence

AAEEDEEFTNITDIKPPLQKPTHSFCAMKVDDGPCRAYIKRFFFNILTHQCEEFIYGGCEGNENRFESLEECKEKCARDYPKMTTKLTFQKGKPDFCFLEEDPGICRGYITRYFYNNQSKQCERFKYGGCLGNLNNFESLEECKNTCENPTSDFQVDDHRTQLNTVNNTLINQPTKAPRRWAFHGPSWCLPPADRGLCQANEIRFFYNAIIGKCRPFKYSGCGGNENNFTSKKACITACKKGFIPKSIKGGLIKTKRKKKKQPVKITYVETFVKKT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Transmembrane protein 121 (TMEM121) ELISA Kit
MBS7224427-01 48 Well

Rat Transmembrane protein 121 (TMEM121) ELISA Kit

Sign In for Pricing
View Details
Rat Transmembrane protein 121 (TMEM121) ELISA Kit
MBS7224427-02 96 Well

Rat Transmembrane protein 121 (TMEM121) ELISA Kit

Sign In for Pricing
View Details
Rat Transmembrane protein 121 (TMEM121) ELISA Kit
MBS7224427-03 5x 96 Well

Rat Transmembrane protein 121 (TMEM121) ELISA Kit

Sign In for Pricing
View Details
Rat Transmembrane protein 121 (TMEM121) ELISA Kit
MBS7224427-04 10x 96 Well

Rat Transmembrane protein 121 (TMEM121) ELISA Kit

Sign In for Pricing
View Details
SPANX Rabbit Polyclonal Antibody (BF488)
orb2395735 100 µL

SPANX Rabbit Polyclonal Antibody (BF488)

Sign In for Pricing
View Details
InhA Polyclonal Antibody, FITC Conjugated
A56220-050 50 µL

InhA Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details