Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Complement C1q tumor necrosis factor-related protein 3 (C1qtnf3)

Recombinant Mouse Complement C1q tumor necrosis factor-related protein 3 (C1qtnf3) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Baculovirus. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: C1qtnf3. Target Synonyms: Collagenous repeat-containing sequence 26 kDa proteinCORS26Secretory protein CORS26Ctrp3. Accession Number: Q9ES30. Expression Region: 23~246aa. Tag Info: N-Terminal 10Xhis-Tagged. Theoretical MW: 26.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Mouse Complement C1q tumor necrosis factor-related protein 3 (C1qtnf3) is a purified Recombinant Protein.

Accession Number

Q9ES30

Expression Region

23~246aa

Host

Baculovirus

Target

C1qtnf3

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged

Field of Research

Metabolism

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

26.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Collagenous repeat-containing sequence 26 kDa proteinCORS26Secretory protein CORS26Ctrp3

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

QDEYMESPQAGGLPPDCSKCCHGDYGFRGYQGPPGPPGPPGIPGNHGNNGNNGATGHEGAKGEKGDKGDLGPRGERGQHGPKGEKGYPGVPPELQIAFMASLATHFSNQNSGIIFSSVETNIGNFFDVMTGRFGAPVSGVYFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYETKGKSDTSSNHAVLKLAKGDEVWLRMGNGALHGDHQRFSTFAGFLLFETK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ABHD1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
11081111 3x 1.0 µg

ABHD1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Bovine BCL2A1/Bcl-2-related protein A1 ELISA Kit
MBS2904773-01 48 Well

Bovine BCL2A1/Bcl-2-related protein A1 ELISA Kit

Sign In for Pricing
View Details
Bovine BCL2A1/Bcl-2-related protein A1 ELISA Kit
MBS2904773-02 96 Well

Bovine BCL2A1/Bcl-2-related protein A1 ELISA Kit

Sign In for Pricing
View Details
Bovine BCL2A1/Bcl-2-related protein A1 ELISA Kit
MBS2904773-03 5x 96 Well

Bovine BCL2A1/Bcl-2-related protein A1 ELISA Kit

Sign In for Pricing
View Details
Bovine BCL2A1/Bcl-2-related protein A1 ELISA Kit
MBS2904773-04 10x 96 Well

Bovine BCL2A1/Bcl-2-related protein A1 ELISA Kit

Sign In for Pricing
View Details
SPOCD1 Rabbit Polyclonal Antibody
orb3069520-01 30 µL

SPOCD1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details