Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human AT-rich interactive domain-containing protein 1A (ARID1A), partial

Recombinant Human AT-rich interactive domain-containing protein 1A (ARID1A), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Baculovirus. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: ARID1A. Target Synonyms: B120BRG1-associated factor 250BAF250BRG1-associated factor 250aBAF250AOsa homolog 1hOSA1SWI-like proteinSWI/SNF complex protein p270SWI/SNF-related. Accession Number: O14497. Expression Region: 1976~2231aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 32.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human AT-rich interactive domain-containing protein 1A (ARID1A), partial is a purified Recombinant Protein.

Accession Number

O14497

Expression Region

1976~2231aa

Host

Baculovirus

Target

ARID1A

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Field of Research

Cancer

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

32.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

B120BRG1-associated factor 250BAF250BRG1-associated factor 250aBAF250AOsa homolog 1hOSA1SWI-like proteinSWI/SNF complex protein p270SWI/SNF-related, matrix-associated, actin-dependent regulator of chromatin subfamily F member 1hELDC1orf4, OSA1, SMARCF1

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

SLAKRCVCVSNTIRSLSFVPGNDFEMSKHPGLLLILGKLILLHHKHPERKQAPLTYEKEEEQDQGVSCNKVEWWWDCLEMLRENTLVTLANISGQLDLSPYPESICLPVLDGLLHWAVCPSAEAQDPFSTLGPNAVLSPQRLVLETLSKLSIQDNNVDLILATPPFSRLEKLYSTMVRFLSDRKNPVCREMAVVLLANLAQGDSLAARAIAVQKGSIGNLLGFLEDSLAATQFQQSQASLLHMQNPPFEPTSVDMM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MS4A3 Recombinant Protein (Mouse)
RP151748 100 µg

MS4A3 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Anti-p53 Ac-K120 (human) antibody, monoclonal (10E5), WB, IP, FC, ELISA, Azide and carrier free
71-131 Inquire

Anti-p53 Ac-K120 (human) antibody, monoclonal (10E5), WB, IP, FC, ELISA, Azide and carrier free

Sign In for Pricing
View Details
CRIPAK sgRNA CRISPR Lentivector set (Human)
K0507601 3x 1.0 µg

CRIPAK sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
DDX28 (NM_018380) Human Untagged Clone
SC320796 10 µg

DDX28 (NM_018380) Human Untagged Clone

Sign In for Pricing
View Details
Recombinant Streptococcus mutans Xaa-Pro dipeptidyl-peptidase (pepX), partial
MBS1317868 Inquire

Recombinant Streptococcus mutans Xaa-Pro dipeptidyl-peptidase (pepX), partial

Sign In for Pricing
View Details
AARD (NM_001025357) Human Tagged ORF Clone Lentiviral Particle
RC214088L3V 200 µL

AARD (NM_001025357) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details