Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Enterotoxin type A (entA), partial

Recombinant Staphylococcus aureus Enterotoxin type A (entA), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Staphylococcus aureus. Target Name: entA. Target Synonyms: SEA. Accession Number: P0A0L2. Expression Region: 25~253aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 30.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Staphylococcus aureus Enterotoxin type A (entA), partial is a purified Recombinant Protein.

Accession Number

P0A0L2

Expression Region

25~253aa

Host

E. coli

Target

EntA

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

30.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

SEA

Species

Staphylococcus aureus

Protein Name

Recombinant Protein

AA Sequence

SEKSEEINEKDLRKKSELQGTALGNLKQIYYYNEKAKTENKESHDQFLQHTILFKGFFTDHSWYNDLLVDFDSKDIVDKYKGKKVDLYGAYYGYQCAGGTPNKTACMYGGVTLHDNNRLTEEKKVPINLWLDGKQNTVPLETVKTNKKNVTVQELDLQARRYLQEKYNLYNSDVFDGKVQRGLIVFHTSTEPSVNYDLFGAQGQYSNTLLRIYRDNKTINSENMHIDIY

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

DCTN1 (150 a Dynein Associated Polypeptide, 150 a Dynein-Associated Polypeptide, DAP 150, DAP-150, DAP150, DCTN 1, DCTN1, DCTN1, DP 150, DP-150, DP150, Dynactin 1 (p150 Glued (Drosophila) Homolog), dynactin 1 (p150 glued Homolog Drosophila), Dynactin 1, Dynactin Subunit 1, Dynactin1, HMN7B, p135, p150 Glued (Drosophila) Homolog, p150 glued, p150 glued Homolog, p150 (GLUED) DROSOPHILA Homolog OF, p150-glued, p150glued) discontinued
222110-01 50 µL

DCTN1 (150 a Dynein Associated Polypeptide, 150 a Dynein-Associated Polypeptide, DAP 150, DAP-150, DAP150, DCTN 1, DCTN1, DCTN1, DP 150, DP-150, DP150, Dynactin 1 (p150 Glued (Drosophila) Homolog), dynactin 1 (p150 glued Homolog Drosophila), Dynactin 1, Dynactin Subunit 1, Dynactin1, HMN7B, p135, p150 Glued (Drosophila) Homolog, p150 glued, p150 glued Homolog, p150 (GLUED) DROSOPHILA Homolog OF, p150-glued, p150glued) discontinued

Ask
View Details
DCTN1 (150 a Dynein Associated Polypeptide, 150 a Dynein-Associated Polypeptide, DAP 150, DAP-150, DAP150, DCTN 1, DCTN1, DCTN1, DP 150, DP-150, DP150, Dynactin 1 (p150 Glued (Drosophila) Homolog), dynactin 1 (p150 glued Homolog Drosophila), Dynactin 1, Dynactin Subunit 1, Dynactin1, HMN7B, p135, p150 Glued (Drosophila) Homolog, p150 glued, p150 glued Homolog, p150 (GLUED) DROSOPHILA Homolog OF, p150-glued, p150glued) discontinued
222110-02 100 µL

DCTN1 (150 a Dynein Associated Polypeptide, 150 a Dynein-Associated Polypeptide, DAP 150, DAP-150, DAP150, DCTN 1, DCTN1, DCTN1, DP 150, DP-150, DP150, Dynactin 1 (p150 Glued (Drosophila) Homolog), dynactin 1 (p150 glued Homolog Drosophila), Dynactin 1, Dynactin Subunit 1, Dynactin1, HMN7B, p135, p150 Glued (Drosophila) Homolog, p150 glued, p150 glued Homolog, p150 (GLUED) DROSOPHILA Homolog OF, p150-glued, p150glued) discontinued

Ask
View Details
Ccrl2 (NM_001108191) Rat Tagged ORF Clone Lentiviral Particle
RR210771L3V 200 µL

Ccrl2 (NM_001108191) Rat Tagged ORF Clone Lentiviral Particle

Ask
View Details
P311 (NREP) (NM_001142481) Human Tagged Lenti ORF Clone
RC227855L3 10 µg

P311 (NREP) (NM_001142481) Human Tagged Lenti ORF Clone

Ask
View Details
Recombinant Lactobacillus casei Holo-[acyl-carrier-protein] synthase (acpS)
MBS1137120-01 0.02 mg (E-Coli)

Recombinant Lactobacillus casei Holo-[acyl-carrier-protein] synthase (acpS)

Ask
View Details
Recombinant Lactobacillus casei Holo-[acyl-carrier-protein] synthase (acpS)
MBS1137120-02 0.1 mg (E-Coli)

Recombinant Lactobacillus casei Holo-[acyl-carrier-protein] synthase (acpS)

Ask
View Details