Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Glutathione S-transferase LANCL1 (LANCL1)

Recombinant Human Glutathione S-transferase LANCL1 (LANCL1) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: LANCL1. Target Synonyms: 40 kDa erythrocyte membrane protein (p40; GPR69A) . Accession Number: O43813. Expression Region: 2~399aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 52.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Glutathione S-transferase LANCL1 (LANCL1) is a purified Recombinant Protein.

Accession Number

O43813

Expression Region

2~399aa

Host

E. coli

Target

LANCL1

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Field of Research

Cardiovascular

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

52.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

40 kDa erythrocyte membrane protein (p40; GPR69A)

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

AQRAFPNPYADYNKSLAEGYFDAAGRLTPEFSQRLTNKIRELLQQMERGLKSADPRDGTGYTGWAGIAVLYLHLYDVFGDPAYLQLAHGYVKQSLNCLTKRSITFLCGDAGPLAVAAVLYHKMNNEKQAEDCITRLIHLNKIDPHAPNEMLYGRIGYIYALLFVNKNFGVEKIPQSHIQQICETILTSGENLARKRNFTAKSPLMYEWYQEYYVGAAHGLAGIYYYLMQPSLQVSQGKLHSLVKPSVDYVCQLKFPSGNYPPCIGDNRDLLVHWCHGAPGVIYMLIQAYKVFREEKYLCDAYQCADVIWQYGLLKKGYGLCHGSAGNAYAFLTLYNLTQDMKYLYRACKFAEWCLEYGEHGCRTPDTPFSLFEGMAGTIYFLADLLVPTKARFPAFEL

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

KIR2DS2, ID (KIR2DS2, CD158J, NKAT5, Killer cell immunoglobulin-like receptor 2DS2, CD158 antigen-like family member J, MHC class I NK cell receptor, NK receptor 183 ActI, Natural killer-associated transcript 5, p58 natural killer cell receptor clone CL-4
MBS6313406-01 0.2 mL

KIR2DS2, ID (KIR2DS2, CD158J, NKAT5, Killer cell immunoglobulin-like receptor 2DS2, CD158 antigen-like family member J, MHC class I NK cell receptor, NK receptor 183 ActI, Natural killer-associated transcript 5, p58 natural killer cell receptor clone CL-4

Ask
View Details
KIR2DS2, ID (KIR2DS2, CD158J, NKAT5, Killer cell immunoglobulin-like receptor 2DS2, CD158 antigen-like family member J, MHC class I NK cell receptor, NK receptor 183 ActI, Natural killer-associated transcript 5, p58 natural killer cell receptor clone CL-4
MBS6313406-02 5x 0.2 mL

KIR2DS2, ID (KIR2DS2, CD158J, NKAT5, Killer cell immunoglobulin-like receptor 2DS2, CD158 antigen-like family member J, MHC class I NK cell receptor, NK receptor 183 ActI, Natural killer-associated transcript 5, p58 natural killer cell receptor clone CL-4

Ask
View Details
Histone H2A Type 1-B/E Recombinant Antibody
RAC07095-01 50 µL

Histone H2A Type 1-B/E Recombinant Antibody

Ask
View Details
Histone H2A Type 1-B/E Recombinant Antibody
RAC07095-02 100 µL

Histone H2A Type 1-B/E Recombinant Antibody

Ask
View Details
Frozen Tissue Sections, Aortic valve
CS511355 5x 5 µm

Frozen Tissue Sections, Aortic valve

Ask
View Details
VISA (Virus-Induced Signaling Adapter, Mitochondrial Antiviral Signaling Protein, MAVS, CARD Adapter Inducing Interferon-beta, Cardif, IPS-1) (MaxLight 750) discontinued
V2124-20F-ML750 100 µL

VISA (Virus-Induced Signaling Adapter, Mitochondrial Antiviral Signaling Protein, MAVS, CARD Adapter Inducing Interferon-beta, Cardif, IPS-1) (MaxLight 750) discontinued

Ask
View Details