Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Glutathione S-transferase LANCL1 (LANCL1)

Recombinant Human Glutathione S-transferase LANCL1 (LANCL1) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: LANCL1. Target Synonyms: 40 kDa erythrocyte membrane protein (p40; GPR69A) . Accession Number: O43813. Expression Region: 2~399aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 52.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Glutathione S-transferase LANCL1 (LANCL1) is a purified Recombinant Protein.

Accession Number

O43813

Expression Region

2~399aa

Host

E. coli

Target

LANCL1

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Field of Research

Cardiovascular

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

52.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

40 kDa erythrocyte membrane protein (p40; GPR69A)

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

AQRAFPNPYADYNKSLAEGYFDAAGRLTPEFSQRLTNKIRELLQQMERGLKSADPRDGTGYTGWAGIAVLYLHLYDVFGDPAYLQLAHGYVKQSLNCLTKRSITFLCGDAGPLAVAAVLYHKMNNEKQAEDCITRLIHLNKIDPHAPNEMLYGRIGYIYALLFVNKNFGVEKIPQSHIQQICETILTSGENLARKRNFTAKSPLMYEWYQEYYVGAAHGLAGIYYYLMQPSLQVSQGKLHSLVKPSVDYVCQLKFPSGNYPPCIGDNRDLLVHWCHGAPGVIYMLIQAYKVFREEKYLCDAYQCADVIWQYGLLKKGYGLCHGSAGNAYAFLTLYNLTQDMKYLYRACKFAEWCLEYGEHGCRTPDTPFSLFEGMAGTIYFLADLLVPTKARFPAFEL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal BAP1 Antibody (BAP1/2431) [PerCP]
NBP3-08477PCP 0.1 mL

Mouse Monoclonal BAP1 Antibody (BAP1/2431) [PerCP]

Sign In for Pricing
View Details
C1orf166 Antibody
GWB-MP435C 50 µg

C1orf166 Antibody

Sign In for Pricing
View Details
Suclg2 3'UTR GFP Stable Cell Line
TU271381 1.0 mL

Suclg2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
VEGFA Protein Vector (Mouse) (pPM-C-HA)
PV245000 500 ng

VEGFA Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
CUGBP2, CT (CELF2, BRUNOL3, CUGBP2, ETR3, NAPOR, CUGBP Elav-like family member 2, Bruno-like protein 3, CUG triplet repeat RNA-binding protein 2, CUG-BP-and ETR-3-like factor 2, ELAV-type RNA-binding protein 3, Neuroblastoma apoptosis-related RNA-binding
MBS6290039-01 0.1 mL

CUGBP2, CT (CELF2, BRUNOL3, CUGBP2, ETR3, NAPOR, CUGBP Elav-like family member 2, Bruno-like protein 3, CUG triplet repeat RNA-binding protein 2, CUG-BP-and ETR-3-like factor 2, ELAV-type RNA-binding protein 3, Neuroblastoma apoptosis-related RNA-binding

Sign In for Pricing
View Details
CUGBP2, CT (CELF2, BRUNOL3, CUGBP2, ETR3, NAPOR, CUGBP Elav-like family member 2, Bruno-like protein 3, CUG triplet repeat RNA-binding protein 2, CUG-BP-and ETR-3-like factor 2, ELAV-type RNA-binding protein 3, Neuroblastoma apoptosis-related RNA-binding
MBS6290039-02 5x 0.1 mL

CUGBP2, CT (CELF2, BRUNOL3, CUGBP2, ETR3, NAPOR, CUGBP Elav-like family member 2, Bruno-like protein 3, CUG triplet repeat RNA-binding protein 2, CUG-BP-and ETR-3-like factor 2, ELAV-type RNA-binding protein 3, Neuroblastoma apoptosis-related RNA-binding

Sign In for Pricing
View Details