Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lentinula edodes Peroxidase (mnp2c)

Recombinant Lentinula edodes Peroxidase (mnp2c) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Lentinula edodes (Shiitake mushroom) (Lentinus edodes) . Target Name: mnp2c. Accession Number: B5U994. Expression Region: 21~377aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 42.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Lentinula edodes Peroxidase (mnp2c) is a purified Recombinant Protein.

Accession Number

B5U994

Expression Region

21~377aa

Host

E. coli

Target

Mnp2c

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

42.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Species

Lentinula edodes (Shiitake mushroom) (Lentinus edodes)

Protein Name

Recombinant Protein

AA Sequence

APAAQNARCSDGTVVPNSICCDFIPLAQDLTETLFENQCGETAHEVLRLSFHDAIAISQSLGPSAGGGADGSMLIFPDVEPNFAANLGISDSVNDLAPFLASGKFPTITAGDMIQFGAAVAVGLCPGAPQLEFRAGRPNATAPAVDGLIPEPQNTVDEILARFQDAANMNAEDIVSLLVSHTVARADHVDPTLDAAPFDSTPFTFDSQFFLETLLTGVGFPGTTNNTGEVSSPLPLTVGDNVGELRLQSDFELARDSRTACFWQSMINQEALMASRFKAAMAKMAVIGHNANDLIDCSAVVPKPVPALNKPATFPATKTKADVQQACPEPFPNLTTDRAPRETEIPHCPDNEATCTS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human BBS9 Pre-designed siRNA Set A
SI001461A 1 Each

Human BBS9 Pre-designed siRNA Set A

Sign In for Pricing
View Details
ATG9A (APG9L1, MGD3208, APG9 autophagy 9-like 1, APG9-like 1, OTTHUMP00000206049, autophagy 9-like 1 protein, autophagy-related protein 9A) (PE) discontinued
032241-PE 200 µL

ATG9A (APG9L1, MGD3208, APG9 autophagy 9-like 1, APG9-like 1, OTTHUMP00000206049, autophagy 9-like 1 protein, autophagy-related protein 9A) (PE) discontinued

Sign In for Pricing
View Details
CNPY3, NT (CNPY3, CTG4A, ERDA5, PRAT4A, TNRC5, Protein canopy homolog 3, CTG repeat protein 4a, Expanded repeat-domain protein CAG/CTG 5, Protein associated with TLR4, Trinucleotide repeat-containing gene 5 protein) (FITC) discontinued
034055-FITC 200 µL

CNPY3, NT (CNPY3, CTG4A, ERDA5, PRAT4A, TNRC5, Protein canopy homolog 3, CTG repeat protein 4a, Expanded repeat-domain protein CAG/CTG 5, Protein associated with TLR4, Trinucleotide repeat-containing gene 5 protein) (FITC) discontinued

Sign In for Pricing
View Details
Grey alder (t2)
ED7690 25 Tests

Grey alder (t2)

Sign In for Pricing
View Details
Matched Pair - cDNA - Human Primary Tumor and Normal Tissue: Liver
C8235149-PP 2x 10 Reactions

Matched Pair - cDNA - Human Primary Tumor and Normal Tissue: Liver

Sign In for Pricing
View Details
SLAP2 (SLA2) Mouse Monoclonal Antibody [Clone ID: OTI2B2]
TA505127 100 µL

SLAP2 (SLA2) Mouse Monoclonal Antibody [Clone ID: OTI2B2]

Sign In for Pricing
View Details