Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lentinula edodes Peroxidase (mnp2c)

Recombinant Lentinula edodes Peroxidase (mnp2c) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Lentinula edodes (Shiitake mushroom) (Lentinus edodes) . Target Name: mnp2c. Accession Number: B5U994. Expression Region: 21~377aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 42.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Lentinula edodes Peroxidase (mnp2c) is a purified Recombinant Protein.

Accession Number

B5U994

Expression Region

21~377aa

Host

E. coli

Target

Mnp2c

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

42.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Species

Lentinula edodes (Shiitake mushroom) (Lentinus edodes)

Protein Name

Recombinant Protein

AA Sequence

APAAQNARCSDGTVVPNSICCDFIPLAQDLTETLFENQCGETAHEVLRLSFHDAIAISQSLGPSAGGGADGSMLIFPDVEPNFAANLGISDSVNDLAPFLASGKFPTITAGDMIQFGAAVAVGLCPGAPQLEFRAGRPNATAPAVDGLIPEPQNTVDEILARFQDAANMNAEDIVSLLVSHTVARADHVDPTLDAAPFDSTPFTFDSQFFLETLLTGVGFPGTTNNTGEVSSPLPLTVGDNVGELRLQSDFELARDSRTACFWQSMINQEALMASRFKAAMAKMAVIGHNANDLIDCSAVVPKPVPALNKPATFPATKTKADVQQACPEPFPNLTTDRAPRETEIPHCPDNEATCTS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal JAM-4/IGSF5 Antibody [Alexa Fluor 350]
NBP2-99581AF350 0.1 mL

Rabbit Polyclonal JAM-4/IGSF5 Antibody [Alexa Fluor 350]

Sign In for Pricing
View Details
BNIP1 (Vesicle Transport Protein SEC20, BCL2/Adenovirus E1B 19kD Protein-interacting Protein 1, Transformation-related Gene 8 Protein, TRG-8, NIP1, SEC20L, TRG8) (MaxLight 490)
123970-ML490 100 µL

BNIP1 (Vesicle Transport Protein SEC20, BCL2/Adenovirus E1B 19kD Protein-interacting Protein 1, Transformation-related Gene 8 Protein, TRG-8, NIP1, SEC20L, TRG8) (MaxLight 490)

Sign In for Pricing
View Details
ITGA7 Antibody Blocking Peptide
orb1506459 500 µg

ITGA7 Antibody Blocking Peptide

Sign In for Pricing
View Details
IQCF2 (NM_203424) Human Tagged ORF Clone Lentiviral Particle
RC208171L4V 200 µL

IQCF2 (NM_203424) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
RAB8A (NM_005370) Human 3' UTR Clone
SC214076 10 µg

RAB8A (NM_005370) Human 3' UTR Clone

Sign In for Pricing
View Details
Slit 2 Antibody, mAb, Rabbit
A03848-50 50 µL

Slit 2 Antibody, mAb, Rabbit

Sign In for Pricing
View Details