Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Gloydius ussuriensis Thrombin-like enzyme calobin-1

Recombinant Gloydius ussuriensis Thrombin-like enzyme calobin-1 is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Gloydius ussuriensis (Ussuri mamushi) (Gloydius blomhoffii ussuriensis) . Target Name: Gloydius ussuriensis Thrombin-like enzyme calobin-1. Target Synonyms: Calobin I (Fibrinogen-clotting enzyme; Snake venom serine protease; SVSP; SVTLE) . Accession Number: Q91053. Expression Region: 25~262aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 33.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Gloydius ussuriensis Thrombin-like enzyme calobin-1 is a purified Recombinant Protein.

Accession Number

Q91053

Expression Region

25~262aa

Host

E. coli

Target

Gloydius ussuriensis Thrombin-like enzyme calobin-1

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

33.7kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Calobin I (Fibrinogen-clotting enzyme; Snake venom serine protease; SVSP; SVTLE)

Species

Gloydius ussuriensis (Ussuri mamushi) (Gloydius blomhoffii ussuriensis)

Protein Name

Recombinant Protein

AA Sequence

VIGGDECNINEHRFLVALYNSRSRTLFCGGTLINQEWVLTAAHCERKNFRIKLGIHSKKVPNEDEQTRVPKEKFFCLSSKNYTLWDKDIMLIRLDSPVSNSEHIAPLSLPSSPPSVGSVCRIMGWGRISPTKETYPDVPHCANINLLEYEMCRAPYPEFGLPATSRTLCAGILEGGKDTCRGDSGGPLICNGQFQGIASWGDDPCAQPHKPAAYTKVFDHLDWIQSIIAGNTDASCPP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDC42SE2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI10A5]
TA808200AM 100 µL

CDC42SE2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI10A5]

Sign In for Pricing
View Details
Guide Cannula-Double/O.D.0.64mm-23G/C.C1.0/B7.8/M3.5
62038 1 PC

Guide Cannula-Double/O.D.0.64mm-23G/C.C1.0/B7.8/M3.5

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli O157:H7 CAIA Polyclonal Antibody
MBS7161206 Inquire

Rabbit anti-Escherichia coli O157:H7 CAIA Polyclonal Antibody

Sign In for Pricing
View Details
FAM234A Antibody, FITC conjugated
A70736-100UG 100 µg

FAM234A Antibody, FITC conjugated

Sign In for Pricing
View Details
Porcine CLDN2 ELISA Kit
EF016720 96 Tests

Porcine CLDN2 ELISA Kit

Sign In for Pricing
View Details
SRI 31215 TFA
MBS3846199-01 5 mg

SRI 31215 TFA

Sign In for Pricing
View Details