Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Gloydius ussuriensis Thrombin-like enzyme calobin-1

Recombinant Gloydius ussuriensis Thrombin-like enzyme calobin-1 is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Gloydius ussuriensis (Ussuri mamushi) (Gloydius blomhoffii ussuriensis) . Target Name: Gloydius ussuriensis Thrombin-like enzyme calobin-1. Target Synonyms: Calobin I (Fibrinogen-clotting enzyme; Snake venom serine protease; SVSP; SVTLE) . Accession Number: Q91053. Expression Region: 25~262aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 33.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Gloydius ussuriensis Thrombin-like enzyme calobin-1 is a purified Recombinant Protein.

Accession Number

Q91053

Expression Region

25~262aa

Host

E. coli

Target

Gloydius ussuriensis Thrombin-like enzyme calobin-1

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

33.7kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Calobin I (Fibrinogen-clotting enzyme; Snake venom serine protease; SVSP; SVTLE)

Species

Gloydius ussuriensis (Ussuri mamushi) (Gloydius blomhoffii ussuriensis)

Protein Name

Recombinant Protein

AA Sequence

VIGGDECNINEHRFLVALYNSRSRTLFCGGTLINQEWVLTAAHCERKNFRIKLGIHSKKVPNEDEQTRVPKEKFFCLSSKNYTLWDKDIMLIRLDSPVSNSEHIAPLSLPSSPPSVGSVCRIMGWGRISPTKETYPDVPHCANINLLEYEMCRAPYPEFGLPATSRTLCAGILEGGKDTCRGDSGGPLICNGQFQGIASWGDDPCAQPHKPAAYTKVFDHLDWIQSIIAGNTDASCPP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATP synthase subunit b
MBS7042283-01 0.02 mg

ATP synthase subunit b

Sign In for Pricing
View Details
ATP synthase subunit b
MBS7042283-02 0.1 mg

ATP synthase subunit b

Sign In for Pricing
View Details
ATP synthase subunit b
MBS7042283-03 5x 0.1 mg

ATP synthase subunit b

Sign In for Pricing
View Details
CTNNA1 Antibody (YA7681, Rabbit)
HY-P87996 1 Each

CTNNA1 Antibody (YA7681, Rabbit)

Sign In for Pricing
View Details
Rabbit Polyclonal ACOX3 Antibody [CoraFluor 1]
NBP2-98600CL1 0.1 mL

Rabbit Polyclonal ACOX3 Antibody [CoraFluor 1]

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Eukaryotic Translation Elongation Factor 2 (EEF2)
MBS2065765-01 0.1 mL

APC-Linked Polyclonal Antibody to Eukaryotic Translation Elongation Factor 2 (EEF2)

Sign In for Pricing
View Details