Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Left-right determination factor 2 (LEFTY2)

Recombinant Human Left-right determination factor 2 (LEFTY2) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: LEFTY2. Target Synonyms: Endometrial bleeding-associated factor (Left-right determination factor A; Protein lefty-2; Protein lefty-A; Transforming growth factor beta-4; TGF-beta-4; EBAF; LEFTA; LEFTYA; TGFB4) . Accession Number: O00292. Expression Region: 77~366aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 39.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Left-right determination factor 2 (LEFTY2) is a purified Recombinant Protein.

Accession Number

O00292

Expression Region

77~366aa

Host

E. coli

Target

LEFTY2

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Field of Research

Cancer

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

39.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Endometrial bleeding-associated factor (Left-right determination factor A; Protein lefty-2; Protein lefty-A; Transforming growth factor beta-4; TGF-beta-4; EBAF; LEFTA; LEFTYA; TGFB4)

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

RFSQSFREVAGRFLASEASTHLLVFGMEQRLPPNSELVQAVLRLFQEPVPKAALHRHGRLSPRSAQARVTVEWLRVRDDGSNRTSLIDSRLVSVHESGWKAFDVTEAVNFWQQLSRPRQPLLLQVSVQREHLGPLASGAHKLVRFASQGAPAGLGEPQLELHTLDLRDYGAQGDCDPEAPMTEGTRCCRQEMYIDLQGMKWAKNWVLEPPGFLAYECVGTCQQPPEALAFNWPFLGPRQCIASETASLPMIVSIKEGGRTRPQVVSLPNMRVQKCSCASDGALVPRRLQP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAB20 Rabbit pAb
A17725-01 20 µL

RAB20 Rabbit pAb

Sign In for Pricing
View Details
RAB20 Rabbit pAb
A17725-02 100 μL

RAB20 Rabbit pAb

Sign In for Pricing
View Details
RAB20 Rabbit pAb
A17725-03 500 μL

RAB20 Rabbit pAb

Sign In for Pricing
View Details
RAB20 Rabbit pAb
A17725-04 1000 μL

RAB20 Rabbit pAb

Sign In for Pricing
View Details
Rabbit Polyclonal TRPC3 Antibody [DyLight 350]
NBP1-77262UV 0.1 mL

Rabbit Polyclonal TRPC3 Antibody [DyLight 350]

Sign In for Pricing
View Details
Exportin 1 Acetyl-Lys568 (XPO1 AcK568) Antibody
abx327218-01 50 µg

Exportin 1 Acetyl-Lys568 (XPO1 AcK568) Antibody

Sign In for Pricing
View Details