Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Left-right determination factor 2 (LEFTY2)

Recombinant Human Left-right determination factor 2 (LEFTY2) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: LEFTY2. Target Synonyms: Endometrial bleeding-associated factor (Left-right determination factor A; Protein lefty-2; Protein lefty-A; Transforming growth factor beta-4; TGF-beta-4; EBAF; LEFTA; LEFTYA; TGFB4) . Accession Number: O00292. Expression Region: 77~366aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 39.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Left-right determination factor 2 (LEFTY2) is a purified Recombinant Protein.

Accession Number

O00292

Expression Region

77~366aa

Host

E. coli

Target

LEFTY2

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Field of Research

Cancer

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

39.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Endometrial bleeding-associated factor (Left-right determination factor A; Protein lefty-2; Protein lefty-A; Transforming growth factor beta-4; TGF-beta-4; EBAF; LEFTA; LEFTYA; TGFB4)

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

RFSQSFREVAGRFLASEASTHLLVFGMEQRLPPNSELVQAVLRLFQEPVPKAALHRHGRLSPRSAQARVTVEWLRVRDDGSNRTSLIDSRLVSVHESGWKAFDVTEAVNFWQQLSRPRQPLLLQVSVQREHLGPLASGAHKLVRFASQGAPAGLGEPQLELHTLDLRDYGAQGDCDPEAPMTEGTRCCRQEMYIDLQGMKWAKNWVLEPPGFLAYECVGTCQQPPEALAFNWPFLGPRQCIASETASLPMIVSIKEGGRTRPQVVSLPNMRVQKCSCASDGALVPRRLQP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Biotinylated Human HLA-A*01:01&B2M&MAGEA3 (EVDPIGHLY) Complex Protein (Monomer, MALS verified)
HL3-H82E4-200ug 200 µg

Biotinylated Human HLA-A*01:01&B2M&MAGEA3 (EVDPIGHLY) Complex Protein (Monomer, MALS verified)

Sign In for Pricing
View Details
14-3-3 η Rabbit Polyclonal Antibody
E28PT0009 100 µL

14-3-3 η Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
KCNQ5, CT (KCNQ5, Potassium voltage-gated channel subfamily KQT member 5, KQT-like 5, Potassium channel subunit alpha KvLQT5, Voltage-gated potassium channel subunit Kv7.5) (MaxLight 650) discontinued
037346-ML650 100 µL

KCNQ5, CT (KCNQ5, Potassium voltage-gated channel subfamily KQT member 5, KQT-like 5, Potassium channel subunit alpha KvLQT5, Voltage-gated potassium channel subunit Kv7.5) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Acrbp sgRNA CRISPR Lentivector (Rat) (Target 3)
K6463204 1.0 µg DNA

Acrbp sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Recombinant GATA3 (phospho S308) Antibody
RC-5571-01 50 μL

Recombinant GATA3 (phospho S308) Antibody

Sign In for Pricing
View Details
Recombinant GATA3 (phospho S308) Antibody
RC-5571-02 100 µL

Recombinant GATA3 (phospho S308) Antibody

Sign In for Pricing
View Details