Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Left-right determination factor 2 (LEFTY2)

Recombinant Human Left-right determination factor 2 (LEFTY2) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: LEFTY2. Target Synonyms: Endometrial bleeding-associated factor (Left-right determination factor A; Protein lefty-2; Protein lefty-A; Transforming growth factor beta-4; TGF-beta-4; EBAF; LEFTA; LEFTYA; TGFB4) . Accession Number: O00292. Expression Region: 77~366aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 39.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Left-right determination factor 2 (LEFTY2) is a purified Recombinant Protein.

Accession Number

O00292

Expression Region

77~366aa

Host

E. coli

Target

LEFTY2

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Field of Research

Cancer

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

39.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Endometrial bleeding-associated factor (Left-right determination factor A; Protein lefty-2; Protein lefty-A; Transforming growth factor beta-4; TGF-beta-4; EBAF; LEFTA; LEFTYA; TGFB4)

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

RFSQSFREVAGRFLASEASTHLLVFGMEQRLPPNSELVQAVLRLFQEPVPKAALHRHGRLSPRSAQARVTVEWLRVRDDGSNRTSLIDSRLVSVHESGWKAFDVTEAVNFWQQLSRPRQPLLLQVSVQREHLGPLASGAHKLVRFASQGAPAGLGEPQLELHTLDLRDYGAQGDCDPEAPMTEGTRCCRQEMYIDLQGMKWAKNWVLEPPGFLAYECVGTCQQPPEALAFNWPFLGPRQCIASETASLPMIVSIKEGGRTRPQVVSLPNMRVQKCSCASDGALVPRRLQP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 18 (KRT18) Mouse Monoclonal Antibody [Clone ID: OTI5E8]
TA500016S 30 µL

Cytokeratin 18 (KRT18) Mouse Monoclonal Antibody [Clone ID: OTI5E8]

Sign In for Pricing
View Details
RNF146 Antibody Blocking Peptide
orb1514838 500 µg

RNF146 Antibody Blocking Peptide

Sign In for Pricing
View Details
RETN (Resistin, ADSF, FIZZ3, MGC126603, MGC126609, RETN1, RSTN, XCP1) (AP)
MBS6162808-01 0.1 mL

RETN (Resistin, ADSF, FIZZ3, MGC126603, MGC126609, RETN1, RSTN, XCP1) (AP)

Sign In for Pricing
View Details
RETN (Resistin, ADSF, FIZZ3, MGC126603, MGC126609, RETN1, RSTN, XCP1) (AP)
MBS6162808-02 5x 0.1 mL

RETN (Resistin, ADSF, FIZZ3, MGC126603, MGC126609, RETN1, RSTN, XCP1) (AP)

Sign In for Pricing
View Details
HAS2 Antibody Blocking Peptide
orb1515189 500 µg

HAS2 Antibody Blocking Peptide

Sign In for Pricing
View Details
Rad6 (UBE2A) (NM_003336) Human Recombinant Protein
TP720160XL 1 mg

Rad6 (UBE2A) (NM_003336) Human Recombinant Protein

Sign In for Pricing
View Details