Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant E. coli Prophage outer membrane lipoprotein RzoR (rzoR)

Recombinant E. coli Prophage outer membrane lipoprotein RzoR (rzoR) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: E. coli (strain K12) . Target Name: rzoR. Target Synonyms: Outer membrane lipoprotein Rz1 from lambdoid prophage Rac (Spanin from lambdoid prophage Rac, outer membrane subunit; o-spanin) . Accession Number: P58042. Expression Region: 20~61aa. Tag Info: N-Terminal 6Xhis-Ksi-Tagged. Theoretical MW: 19.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant E. coli Prophage outer membrane lipoprotein RzoR (rzoR) is a purified Recombinant Protein.

Accession Number

P58042

Expression Region

20~61aa

Host

E. coli

Target

RzoR

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Ksi-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

19.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Outer membrane lipoprotein Rz1 from lambdoid prophage Rac (Spanin from lambdoid prophage Rac, outer membrane subunit; o-spanin)

Species

E. coli (strain K12)

Protein Name

Recombinant Protein

AA Sequence

CTSKQSVSQCVKPPPPPAWIMQPPPDWQTPLNGIISPSGNDW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ERN1 AAV siRNA Pooled Vector
19438161 1.0 µg

ERN1 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
GPT (Glutamic-Pyruvate Transaminase (alanine Aminotransferase), AAT1, ALT1, GPT1) (MaxLight 750)
MBS6238506-01 0.1 mL

GPT (Glutamic-Pyruvate Transaminase (alanine Aminotransferase), AAT1, ALT1, GPT1) (MaxLight 750)

Sign In for Pricing
View Details
GPT (Glutamic-Pyruvate Transaminase (alanine Aminotransferase), AAT1, ALT1, GPT1) (MaxLight 750)
MBS6238506-02 5x 0.1 mL

GPT (Glutamic-Pyruvate Transaminase (alanine Aminotransferase), AAT1, ALT1, GPT1) (MaxLight 750)

Sign In for Pricing
View Details
Plastic Cups
T1021370/A 1 Each

Plastic Cups

Sign In for Pricing
View Details
Ethyl 2,3-di-O-benzoyl-4,6-O-benzylidene-β-D-thiogalactopyranoside
ME15728-01 1 g

Ethyl 2,3-di-O-benzoyl-4,6-O-benzylidene-β-D-thiogalactopyranoside

Sign In for Pricing
View Details
Ethyl 2,3-di-O-benzoyl-4,6-O-benzylidene-β-D-thiogalactopyranoside
ME15728-02 2 g

Ethyl 2,3-di-O-benzoyl-4,6-O-benzylidene-β-D-thiogalactopyranoside

Sign In for Pricing
View Details