Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Calcium-activated potassium channel subunit alpha-1 (KCNMA1), partial

Recombinant Human Calcium-activated potassium channel subunit alpha-1 (KCNMA1), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: KCNMA1. Target Synonyms: BK channel (BKCA alpha; Calcium-activated potassium channel, subfamily M subunit alpha-1; K (VCA) alpha; KCa1.1; Maxi K channel; MaxiK; Slo-alpha; Slo1; Slowpoke homolog; Slo homolog; hSlo; KCNMA; SLO) . Accession Number: Q12791. Expression Region: 411~560aa. Tag Info: Tag-Free. Theoretical MW: 17.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Calcium-activated potassium channel subunit alpha-1 (KCNMA1), partial is a purified Recombinant Protein.

Accession Number

Q12791

Expression Region

411~560aa

Host

E. coli

Target

KCNMA1

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Cancer

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

17.2kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

BK channel (BKCA alpha; Calcium-activated potassium channel, subfamily M subunit alpha-1; K (VCA) alpha; KCa1.1; Maxi K channel; MaxiK; Slo-alpha; Slo1; Slowpoke homolog; Slo homolog; hSlo; KCNMA; SLO)

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

VVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD44 Standard (DF1485), CF405M conjugate, 0.1mg/mL
BNC051037-100 1x 100 µL

CD44 Standard (DF1485), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (E3), CF647 conjugate, 0.1mg/mL
BNC470158-100 1x 100 µL

Cytokeratin 17 (E3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF405S conjugate, 0.1mg/mL
BNC040026-500 1x 500 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/2980R), CF405S conjugate, 0.1mg/mL
BNC042980-100 1x 100 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/2980R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A / MLANA (Melanoma Marker) (rMLANA/788), CF405S conjugate, 0.1mg/mL
BNC041812-500 1x 500 µL

MART-1 / Melan-A / MLANA (Melanoma Marker) (rMLANA/788), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HER-2 / c-erbB-2 / neu / CD340 (ERBB2/2453), CF488A conjugate, 0.1mg/mL
BNC882453-100 1x 100 µL

HER-2 / c-erbB-2 / neu / CD340 (ERBB2/2453), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details