Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza B virus Nuclear export protein (NS)

Recombinant Influenza B virus Nuclear export protein (NS) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Influenza B virus (strain B/Yamagata/1/1973) . Target Name: NS. Target Synonyms: Non-structural protein 2 (NS2; NEP) . Accession Number: P08014. Expression Region: 1~122aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 21.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Influenza B virus Nuclear export protein (NS) is a purified Recombinant Protein.

Accession Number

P08014

Expression Region

1~122aa

Host

E. coli

Target

NS

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Field of Research

Microbiology

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

21.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Non-structural protein 2 (NS2; NEP)

Species

Influenza B virus (strain B/Yamagata/1/1973)

Protein Name

Recombinant Protein

AA Sequence

MADNMTTTQIEWRMKKMAIGSSTHSSSVLMKDIQSQFEQLKLRWESYPNLVKSTDYHQRRETIRLVTEELYLLSKRIDDNILFHKTVIANSSIIADMIVSLSLLETLYEMKDVVEVYSRQCL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Biotin-Linked Polyclonal Antibody to Myosin Heavy Chain 3, Skeletal Muscle, Embryonic (MYH3)
MBS2095266-01 0.1 mL

Biotin-Linked Polyclonal Antibody to Myosin Heavy Chain 3, Skeletal Muscle, Embryonic (MYH3)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Myosin Heavy Chain 3, Skeletal Muscle, Embryonic (MYH3)
MBS2095266-02 0.2 mL

Biotin-Linked Polyclonal Antibody to Myosin Heavy Chain 3, Skeletal Muscle, Embryonic (MYH3)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Myosin Heavy Chain 3, Skeletal Muscle, Embryonic (MYH3)
MBS2095266-03 0.5 mL

Biotin-Linked Polyclonal Antibody to Myosin Heavy Chain 3, Skeletal Muscle, Embryonic (MYH3)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Myosin Heavy Chain 3, Skeletal Muscle, Embryonic (MYH3)
MBS2095266-04 1 mL

Biotin-Linked Polyclonal Antibody to Myosin Heavy Chain 3, Skeletal Muscle, Embryonic (MYH3)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Myosin Heavy Chain 3, Skeletal Muscle, Embryonic (MYH3)
MBS2095266-05 5 mL

Biotin-Linked Polyclonal Antibody to Myosin Heavy Chain 3, Skeletal Muscle, Embryonic (MYH3)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Myosin Heavy Chain 3, Skeletal Muscle, Embryonic (MYH3)
MBS2095266-06 5x 5 mL

Biotin-Linked Polyclonal Antibody to Myosin Heavy Chain 3, Skeletal Muscle, Embryonic (MYH3)

Sign In for Pricing
View Details