Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza B virus Nuclear export protein (NS)

Recombinant Influenza B virus Nuclear export protein (NS) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Influenza B virus (strain B/Yamagata/1/1973) . Target Name: NS. Target Synonyms: Non-structural protein 2 (NS2; NEP) . Accession Number: P08014. Expression Region: 1~122aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 21.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Influenza B virus Nuclear export protein (NS) is a purified Recombinant Protein.

Accession Number

P08014

Expression Region

1~122aa

Host

E. coli

Target

NS

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Field of Research

Microbiology

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

21.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Non-structural protein 2 (NS2; NEP)

Species

Influenza B virus (strain B/Yamagata/1/1973)

Protein Name

Recombinant Protein

AA Sequence

MADNMTTTQIEWRMKKMAIGSSTHSSSVLMKDIQSQFEQLKLRWESYPNLVKSTDYHQRRETIRLVTEELYLLSKRIDDNILFHKTVIANSSIIADMIVSLSLLETLYEMKDVVEVYSRQCL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vmn2r71 AAV siRNA Pooled Vector
49816164 1.0 µg

Vmn2r71 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
LRRC1 Over-expression Lysate Product
GWB-568EC0 0.1 mg

LRRC1 Over-expression Lysate Product

Sign In for Pricing
View Details
Porcine Amyloid Beta Peptide 1-40 A Beta1-40 ELISA Kit
BG-POR10333 1 Each

Porcine Amyloid Beta Peptide 1-40 A Beta1-40 ELISA Kit

Sign In for Pricing
View Details
HSV 1/2 IgG/IgM Combo Rapid Test Cassette
ISGM-425 25 Tests

HSV 1/2 IgG/IgM Combo Rapid Test Cassette

Sign In for Pricing
View Details
GBA2 Antibody
A69546-100UG 100 µg

GBA2 Antibody

Sign In for Pricing
View Details
Anti-PAPLN Antibody (R2W29)
RHB65101 100 μg

Anti-PAPLN Antibody (R2W29)

Sign In for Pricing
View Details