Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat COMM domain-containing protein 5 (Commd5)

Recombinant Rat COMM domain-containing protein 5 (Commd5) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Rat (Rattus norvegicus) . Target Name: Commd5. Target Synonyms: Hypertension-related calcium-regulated gene protein (HCaRG) . Accession Number: Q9ERR2. Expression Region: 2~224aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 31.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Rat COMM domain-containing protein 5 (Commd5) is a purified Recombinant Protein.

Accession Number

Q9ERR2

Expression Region

2~224aa

Host

E. coli

Target

Commd5

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Field of Research

Epigenetics, Nuclear Signaling

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

31.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Hypertension-related calcium-regulated gene protein (HCaRG)

Species

Rat (Rattus norvegicus)

Protein Name

Recombinant Protein

AA Sequence

SALGAAAPYLHHPADSHSGRVSFLGSQPSPEVTAVAQLLKDLDRSTFRKLLKLVVGALHGKDCREAVEQLGASANLSEERLAVLLAGTHTLLQQALRLPPASLKPDAFQEELQELGIPQDLIGDLASLAFGSQRPLLDSVAQQQGSSLPHVSYFRWRVDVAISTSAQSRSLQPSVLMQLKLTDGSAHRFEVPIAKFQELRYSVALVLKEMAELEKKCERKLQD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPM1K Antibody; Biotin conjugated
MBS7001796-01 0.05 mg

PPM1K Antibody; Biotin conjugated

Sign In for Pricing
View Details
PPM1K Antibody; Biotin conjugated
MBS7001796-02 0.1 mg

PPM1K Antibody; Biotin conjugated

Sign In for Pricing
View Details
PPM1K Antibody; Biotin conjugated
MBS7001796-03 5x 0.1 mg

PPM1K Antibody; Biotin conjugated

Sign In for Pricing
View Details
SLC1A2 antibody - middle region
MBS3201745-01 0.1 mL

SLC1A2 antibody - middle region

Sign In for Pricing
View Details
SLC1A2 antibody - middle region
MBS3201745-02 5x 0.1 mL

SLC1A2 antibody - middle region

Sign In for Pricing
View Details
Phospho-TrkA (tyr490) /TrkB (Tyr516) Rabbit pAb
E2382905 100 µL

Phospho-TrkA (tyr490) /TrkB (Tyr516) Rabbit pAb

Sign In for Pricing
View Details