Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat COMM domain-containing protein 5 (Commd5)

Recombinant Rat COMM domain-containing protein 5 (Commd5) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Rat (Rattus norvegicus) . Target Name: Commd5. Target Synonyms: Hypertension-related calcium-regulated gene protein (HCaRG) . Accession Number: Q9ERR2. Expression Region: 2~224aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 31.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Rat COMM domain-containing protein 5 (Commd5) is a purified Recombinant Protein.

Accession Number

Q9ERR2

Expression Region

2~224aa

Host

E. coli

Target

Commd5

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Field of Research

Epigenetics, Nuclear Signaling

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

31.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Hypertension-related calcium-regulated gene protein (HCaRG)

Species

Rat (Rattus norvegicus)

Protein Name

Recombinant Protein

AA Sequence

SALGAAAPYLHHPADSHSGRVSFLGSQPSPEVTAVAQLLKDLDRSTFRKLLKLVVGALHGKDCREAVEQLGASANLSEERLAVLLAGTHTLLQQALRLPPASLKPDAFQEELQELGIPQDLIGDLASLAFGSQRPLLDSVAQQQGSSLPHVSYFRWRVDVAISTSAQSRSLQPSVLMQLKLTDGSAHRFEVPIAKFQELRYSVALVLKEMAELEKKCERKLQD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

JHDM1D Rabbit Polyclonal Antibody (Cy5)
orb948999 100 µL

JHDM1D Rabbit Polyclonal Antibody (Cy5)

Sign In for Pricing
View Details
Fish Laminin Alpha 4 ELISA Kit
MBS076754 Inquire

Fish Laminin Alpha 4 ELISA Kit

Sign In for Pricing
View Details
LV401 rabbit pAb
E44H13806 100 µL

LV401 rabbit pAb

Sign In for Pricing
View Details
Oxysterols receptor LXR alpha Antibody
abx110068-01 20 µg

Oxysterols receptor LXR alpha Antibody

Sign In for Pricing
View Details
Oxysterols receptor LXR alpha Antibody
abx110068-02 50 µg

Oxysterols receptor LXR alpha Antibody

Sign In for Pricing
View Details
Oxysterols receptor LXR alpha Antibody
abx110068-03 100 µg

Oxysterols receptor LXR alpha Antibody

Sign In for Pricing
View Details