Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ralstonia pickettii Poly (3-hydroxybutyrate) depolymerase

Recombinant Ralstonia pickettii Poly (3-hydroxybutyrate) depolymerase is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Ralstonia pickettii (Burkholderia pickettii) . Target Name: Ralstonia pickettii Poly (3-hydroxybutyrate) depolymerase. Target Synonyms: Poly (3-hydroxybutyrate) depolymerase; PHB depolymerase; EC 3.1.1.75. Accession Number: P12625. Expression Region: 28~488aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 50.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Ralstonia pickettii Poly (3-hydroxybutyrate) depolymerase is a purified Recombinant Protein.

Accession Number

P12625

Expression Region

28~488aa

Host

E. coli

Target

Ralstonia pickettii Poly (3-hydroxybutyrate) depolymerase

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

50.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Poly (3-hydroxybutyrate) depolymerase; PHB depolymerase; EC 3.1.1.75

Species

Ralstonia pickettii (Burkholderia pickettii)

Protein Name

Recombinant Protein

AA Sequence

ATAGPGAWSSQQTWAADSVNGGNLTGYFYWPASQPTTPNGKRALVLVLHGCVQTASGDVIDNANGAGFNWKSVADQYGAVILAPNATGNVYSNHCWDYANASPSRTAGHVGVLLDLVNRFVTNSQYAIDPNQVYVAGLSSGGGMTMVLGCIAPDIFAGIGINAGPPPGTTTAQIGYVPSGFTATTAANKCNAWAGSNAGKFSTQIAGAVWGTSDYTVAQAYGPMDAAAMRLVYGGNFTQGSQVSISGGGTNTPYTDSNGKVRTHEISVSGMAHAWPAGTGGDNTNYVDATHINYPVFVMDYWVKNNLRAGSGTGQAGSAPTGLAVTATTSTSVSLSWNAVANASSYGVYRNGSKVGSATATAYTDSGLIAGTTYSYTVTAVDPTAGESQPSAAVSATTKSAFTCTATTASNYAHVQAGRAHDSGGIAYANGSNQSMGLDNLFYTSTLAQTAAGYYIVGNCP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DIAPH2 Antibody, Clone V78 P3C10-D3: Alkaline Phosphatase
MBS8004022-01 0.1 mg

DIAPH2 Antibody, Clone V78 P3C10-D3: Alkaline Phosphatase

Sign In for Pricing
View Details
DIAPH2 Antibody, Clone V78 P3C10-D3: Alkaline Phosphatase
MBS8004022-02 5x 0.1 mg

DIAPH2 Antibody, Clone V78 P3C10-D3: Alkaline Phosphatase

Sign In for Pricing
View Details
TRNAT14 Protein Vector (Human) (pPM-C-HA)
48407021 500 ng

TRNAT14 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Mouse Abca9 qPCR Primer Pair
QM56254S 200 Tests

Mouse Abca9 qPCR Primer Pair

Sign In for Pricing
View Details
Dysferlin Antibody
GWB-D373E5 0.5 mL

Dysferlin Antibody

Sign In for Pricing
View Details
Human Glut1 Alexa Fluor 594 Antibody (Clone 202915)
FAB1418T-100UG 100 µg

Human Glut1 Alexa Fluor 594 Antibody (Clone 202915)

Sign In for Pricing
View Details