Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Complement C5 (C5)

Recombinant Rat Complement C5 (C5) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Rat (Rattus norvegicus) . Target Name: C5. Target Synonyms: C5Complement C5 [Cleaved into: C5a anaphylatoxin]; Fragment. Accession Number: P08650. Expression Region: 1~77aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 14.0kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Rat Complement C5 (C5) is a purified Recombinant Protein.

Accession Number

P08650

Expression Region

1~77aa

Host

E. coli

Target

C5

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Field of Research

Immunology

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

14.0kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

C5Complement C5 [Cleaved into: C5a anaphylatoxin]; Fragment

Species

Rat (Rattus norvegicus)

Protein Name

Recombinant Protein

AA Sequence

DLQLLHQKVEEQAAKYKHRVPKKCCYDGARENKYETCEQRVARVTIGPHCIRAFNECCTIADKIRKESHHKGMLLGR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Runt Related Transcription Factor 1 (RUNX1), Recombinant, Human, His-Tag
050080-01 10 µg

Runt Related Transcription Factor 1 (RUNX1), Recombinant, Human, His-Tag

Sign In for Pricing
View Details
Runt Related Transcription Factor 1 (RUNX1), Recombinant, Human, His-Tag
050080-02 50 µg

Runt Related Transcription Factor 1 (RUNX1), Recombinant, Human, His-Tag

Sign In for Pricing
View Details
Runt Related Transcription Factor 1 (RUNX1), Recombinant, Human, His-Tag
050080-03 100 µg

Runt Related Transcription Factor 1 (RUNX1), Recombinant, Human, His-Tag

Sign In for Pricing
View Details
Runt Related Transcription Factor 1 (RUNX1), Recombinant, Human, His-Tag
050080-04 200 µg

Runt Related Transcription Factor 1 (RUNX1), Recombinant, Human, His-Tag

Sign In for Pricing
View Details
Polyclonal PTCHD2 Antibody
AMR09591G 0.1 mg

Polyclonal PTCHD2 Antibody

Sign In for Pricing
View Details
pLV3-CMV-Mcl1-3×FLAG-Puro Plasmid
PVT49819 2 µg

pLV3-CMV-Mcl1-3×FLAG-Puro Plasmid

Sign In for Pricing
View Details