Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cricetulus griseus Peroxiredoxin-1 (PRDX1)

Recombinant Cricetulus griseus Peroxiredoxin-1 (PRDX1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus) . Target Name: PRDX1. Target Synonyms: Thioredoxin peroxidase 2 (TPX-2; TDPX2) . Accession Number: Q9JKY1. Expression Region: 2~199aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 24.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Cricetulus griseus Peroxiredoxin-1 (PRDX1) is a purified Recombinant Protein.

Accession Number

Q9JKY1

Expression Region

2~199aa

Host

Yeast

Target

PRDX1

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Field of Research

Cardiovascular

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

24.2kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Thioredoxin peroxidase 2 (TPX-2; TDPX2)

Species

Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus)

Protein Name

Recombinant Protein

AA Sequence

SSGNAKIGYPAPNFKATAVMPDGQFRDICLSEYRGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWINTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITINDLPVGRSVDEILRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Magic™ Membrane Protein Human OR14A2 (Olfactory receptor family 14 subfamily A member 2) Full Length
MPC3404K Each

Magic™ Membrane Protein Human OR14A2 (Olfactory receptor family 14 subfamily A member 2) Full Length

Sign In for Pricing
View Details
Mouse Monoclonal HspA1B Antibody (HSPA1B/7627) [Biotin]
NBP3-24280B 0.1 mL

Mouse Monoclonal HspA1B Antibody (HSPA1B/7627) [Biotin]

Sign In for Pricing
View Details
HOMER1 Polyclonal Antibody, Biotin Conjugated
A52489-100 100 µL

HOMER1 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
Lentiviral mouse Cdc6 shRNA (UAS) - Lentiviral mouseCdc6 shRNA (UAS, GFP) (25)
GTR15216680 1 Vial

Lentiviral mouse Cdc6 shRNA (UAS) - Lentiviral mouseCdc6 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Rabbit F (ab') 2 Anti-Goat IgG (H+L) -AP
6020-04 1.0 mL

Rabbit F (ab') 2 Anti-Goat IgG (H+L) -AP

Sign In for Pricing
View Details
Anti-Glycoprotein 2 of Andes Virus IgG fraction (Monoclonal). Clone 1B5/E9
HNM-6023AZ1-5 100 µg

Anti-Glycoprotein 2 of Andes Virus IgG fraction (Monoclonal). Clone 1B5/E9

Sign In for Pricing
View Details