Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant E. coli Major outer membrane lipoprotein Lpp (lpp)

Recombinant E. coli Major outer membrane lipoprotein Lpp (lpp) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: E. coli (strain K12) . Target Name: lpp. Target Synonyms: Braun lipoprotein (Murein-lipoprotein; mlpA; mulI) . Accession Number: P69776. Expression Region: 21~78aa. Tag Info: N-Terminal 6Xhis-Ksi-Tagged. Theoretical MW: 21.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant E. coli Major outer membrane lipoprotein Lpp (lpp) is a purified Recombinant Protein.

Accession Number

P69776

Expression Region

21~78aa

Host

E. coli

Target

Lpp

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Ksi-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

21.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Braun lipoprotein (Murein-lipoprotein; mlpA; mulI)

Species

E. coli (strain K12)

Protein Name

Recombinant Protein

AA Sequence

CSSNAKIDQLSSDVQTLNAKVDQLSNDVNAMRSDVQAAKDDAARANQRLDNMATKYRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human FOLR1 shRNA Plasmid
abx951641-01 150 µg

Human FOLR1 shRNA Plasmid

Sign In for Pricing
View Details
Human FOLR1 shRNA Plasmid
abx951641-02 300 µg

Human FOLR1 shRNA Plasmid

Sign In for Pricing
View Details
Mouse Ephrin B2 (EFNB2) ELISA Kit
DL-EFNB2-Mu-01 48 Tests

Mouse Ephrin B2 (EFNB2) ELISA Kit

Sign In for Pricing
View Details
Mouse Ephrin B2 (EFNB2) ELISA Kit
DL-EFNB2-Mu-02 96 Tests

Mouse Ephrin B2 (EFNB2) ELISA Kit

Sign In for Pricing
View Details
Checkpoint Kinase Activity Immunoblot Kit
STA-413 20 Assays

Checkpoint Kinase Activity Immunoblot Kit

Sign In for Pricing
View Details
Human ULBP2 Pre-designed siRNA Set A
SI017824A 1 Each

Human ULBP2 Pre-designed siRNA Set A

Sign In for Pricing
View Details