Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant E. coli Major outer membrane lipoprotein Lpp (lpp)

Recombinant E. coli Major outer membrane lipoprotein Lpp (lpp) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: E. coli (strain K12) . Target Name: lpp. Target Synonyms: Braun lipoprotein (Murein-lipoprotein; mlpA; mulI) . Accession Number: P69776. Expression Region: 21~78aa. Tag Info: N-Terminal 6Xhis-Ksi-Tagged. Theoretical MW: 21.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant E. coli Major outer membrane lipoprotein Lpp (lpp) is a purified Recombinant Protein.

Accession Number

P69776

Expression Region

21~78aa

Host

E. coli

Target

Lpp

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Ksi-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

21.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Braun lipoprotein (Murein-lipoprotein; mlpA; mulI)

Species

E. coli (strain K12)

Protein Name

Recombinant Protein

AA Sequence

CSSNAKIDQLSSDVQTLNAKVDQLSNDVNAMRSDVQAAKDDAARANQRLDNMATKYRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lenti ORF clone of Selm (Myc-DDK-tagged ORF) - Rat selenoprotein M (Selm), (10 ug), (Note: selenocysteine protein, Internal stop codon present. s
RR208874L3 10 µg

Lenti ORF clone of Selm (Myc-DDK-tagged ORF) - Rat selenoprotein M (Selm), (10 ug), (Note: selenocysteine protein, Internal stop codon present. s

Sign In for Pricing
View Details
COL5A3 (Collagen alpha-3(V) Chain) (MaxLight 405)
MBS6189552-01 0.1 mL

COL5A3 (Collagen alpha-3(V) Chain) (MaxLight 405)

Sign In for Pricing
View Details
COL5A3 (Collagen alpha-3(V) Chain) (MaxLight 405)
MBS6189552-02 5x 0.1 mL

COL5A3 (Collagen alpha-3(V) Chain) (MaxLight 405)

Sign In for Pricing
View Details
CD300E, ID (CD300E, CD300LE, CLM2, CMRF35A5, IREM2, CMRF35-like molecule 2, CD300 antigen-like family member E, CMRF35-A5, Immune receptor expressed on myeloid cells 2, Polymeric immunoglobulin receptor 2, CD300e) (PE)
MBS6283048-01 0.2 mL

CD300E, ID (CD300E, CD300LE, CLM2, CMRF35A5, IREM2, CMRF35-like molecule 2, CD300 antigen-like family member E, CMRF35-A5, Immune receptor expressed on myeloid cells 2, Polymeric immunoglobulin receptor 2, CD300e) (PE)

Sign In for Pricing
View Details
CD300E, ID (CD300E, CD300LE, CLM2, CMRF35A5, IREM2, CMRF35-like molecule 2, CD300 antigen-like family member E, CMRF35-A5, Immune receptor expressed on myeloid cells 2, Polymeric immunoglobulin receptor 2, CD300e) (PE)
MBS6283048-02 5x 0.2 mL

CD300E, ID (CD300E, CD300LE, CLM2, CMRF35A5, IREM2, CMRF35-like molecule 2, CD300 antigen-like family member E, CMRF35-A5, Immune receptor expressed on myeloid cells 2, Polymeric immunoglobulin receptor 2, CD300e) (PE)

Sign In for Pricing
View Details
Klf8 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K3905908 1.0 µg DNA

Klf8 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details