Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Helicobacter pylori Urease subunit alpha (ureA)

Recombinant Helicobacter pylori Urease subunit alpha (ureA) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) . Target Name: ureA. Target Synonyms: Urea amidohydrolase subunit alpha. Accession Number: P14916. Expression Region: 1~238aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 30.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Helicobacter pylori Urease subunit alpha (ureA) is a purified Recombinant Protein.

Accession Number

P14916

Expression Region

1~238aa

Host

E. coli

Target

UreA

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

30.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Urea amidohydrolase subunit alpha

Species

Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)

Protein Name

Recombinant Protein

AA Sequence

MKLTPKELDKLMLHYAGELAKKRKEKGIKLNYVEAVALISAHIMEEARAGKKTAAELMQEGRTLLKPDDVMDGVASMIHEVGIEAMFPDGTKLVTVHTPIEANGKLVPGELFLKNEDITINEGKKAVSVKVKNVGDRPVQIGSHFHFFEVNRCLDFDREKTFGKRLDIASGTAVRFEPGEEKSVELIDIGGNRRIFGFNALVDRQADNESKKIALHRAKERGFHGAKSDDNYVKTIKE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat Protein Disulfide Isomerase ELISA Kit
MBS741033-01 48 Well

Goat Protein Disulfide Isomerase ELISA Kit

Sign In for Pricing
View Details
Goat Protein Disulfide Isomerase ELISA Kit
MBS741033-02 96 Well

Goat Protein Disulfide Isomerase ELISA Kit

Sign In for Pricing
View Details
Goat Protein Disulfide Isomerase ELISA Kit
MBS741033-03 5x 96 Well

Goat Protein Disulfide Isomerase ELISA Kit

Sign In for Pricing
View Details
Goat Protein Disulfide Isomerase ELISA Kit
MBS741033-04 10x 96 Well

Goat Protein Disulfide Isomerase ELISA Kit

Sign In for Pricing
View Details
N- (4-Aminophenyl) -4-ethoxybenzamide
sc-329955 500 mg

N- (4-Aminophenyl) -4-ethoxybenzamide

Sign In for Pricing
View Details
Recombinant Borrelia recurrentis Leucine--tRNA ligase (leuS), partial
MBS1031664 Inquire

Recombinant Borrelia recurrentis Leucine--tRNA ligase (leuS), partial

Sign In for Pricing
View Details