Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Apium graveolens Major allergen Api g 1, isoallergen 1

Recombinant Apium graveolens Major allergen Api g 1, isoallergen 1 is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Apium graveolens (Celery) . Target Name: Apium graveolens Major allergen Api g 1, isoallergen 1. Target Synonyms: Allergen Api g 1.0101Allergen Api g IAllergen: Api g 1. Accession Number: P49372. Expression Region: 1~154aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 32.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Apium graveolens Major allergen Api g 1, isoallergen 1 is a purified Recombinant Protein.

Accession Number

P49372

Expression Region

1~154aa

Host

E. coli

Target

Apium graveolens Major allergen Api g 1, isoallergen 1

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Field of Research

Allergen

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

32.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Allergen Api g 1.0101Allergen Api g IAllergen: Api g 1

Species

Apium graveolens (Celery)

Protein Name

Recombinant Protein

AA Sequence

MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEIKGDGGPGTLKIITLPDGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAIFHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACKR3 Human shRNA Plasmid Kit (Locus ID 57007)
TL305345 1 Kit

ACKR3 Human shRNA Plasmid Kit (Locus ID 57007)

Sign In for Pricing
View Details
Rabbit anti-PTRH2 Antibody
MBS4510220-01 0.05 mL

Rabbit anti-PTRH2 Antibody

Sign In for Pricing
View Details
Rabbit anti-PTRH2 Antibody
MBS4510220-02 0.1 mL

Rabbit anti-PTRH2 Antibody

Sign In for Pricing
View Details
Rabbit anti-PTRH2 Antibody
MBS4510220-03 5x 0.1 mL

Rabbit anti-PTRH2 Antibody

Sign In for Pricing
View Details
Mouse Monoclonal Asialoglycoprotein Receptor 2 Antibody (OTI2A12) [Alexa Fluor 532]
NBP2-70212AF532 0.1 mL

Mouse Monoclonal Asialoglycoprotein Receptor 2 Antibody (OTI2A12) [Alexa Fluor 532]

Sign In for Pricing
View Details
Human TERT knockout cell line
ABC-KH15287 1 Vial

Human TERT knockout cell line

Sign In for Pricing
View Details