Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Apium graveolens Major allergen Api g 1, isoallergen 1

Recombinant Apium graveolens Major allergen Api g 1, isoallergen 1 is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Apium graveolens (Celery) . Target Name: Apium graveolens Major allergen Api g 1, isoallergen 1. Target Synonyms: Allergen Api g 1.0101Allergen Api g IAllergen: Api g 1. Accession Number: P49372. Expression Region: 1~154aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 32.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Apium graveolens Major allergen Api g 1, isoallergen 1 is a purified Recombinant Protein.

Accession Number

P49372

Expression Region

1~154aa

Host

E. coli

Target

Apium graveolens Major allergen Api g 1, isoallergen 1

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Field of Research

Allergen

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

32.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Allergen Api g 1.0101Allergen Api g IAllergen: Api g 1

Species

Apium graveolens (Celery)

Protein Name

Recombinant Protein

AA Sequence

MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEIKGDGGPGTLKIITLPDGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAIFHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-IL-9R [AH9R2]
MBS488657-01 0.2 mg

Anti-IL-9R [AH9R2]

Sign In for Pricing
View Details
Anti-IL-9R [AH9R2]
MBS488657-02 5x 0.2 mg

Anti-IL-9R [AH9R2]

Sign In for Pricing
View Details
VGLL3 Mouse Monoclonal Antibody [Clone ID: LBI3C7]
AMM20904VCF 100 µg

VGLL3 Mouse Monoclonal Antibody [Clone ID: LBI3C7]

Sign In for Pricing
View Details
KD-Validated Anti-Phospho-RSK1 (S380) Rabbit Monoclonal Antibody
AGI1281-100 100 µL

KD-Validated Anti-Phospho-RSK1 (S380) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
SPTBN2 (NM_006946) Human Untagged Clone
SC303857 10 µg

SPTBN2 (NM_006946) Human Untagged Clone

Sign In for Pricing
View Details
Canine Transmembrane protein 11, mitochondrial (TMEM11) ELISA Kit
MBS7200476-01 48 Well

Canine Transmembrane protein 11, mitochondrial (TMEM11) ELISA Kit

Sign In for Pricing
View Details