Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Interleukin-8 (CXCL8), partial

Recombinant Chicken Interleukin-8 (CXCL8), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Chicken (Gallus) . Target Name: CXCL8. Target Synonyms: 9E3C-X-C motif chemokine EF-4Chemokine (C-X-C motif) ligand 8Embryo fibroblast protein 1; EMF-1. Accession Number: P08317. Expression Region: 17~102aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 13.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Chicken Interleukin-8 (CXCL8), partial is a purified Recombinant Protein.

Accession Number

P08317

Expression Region

17~102aa

Host

E. coli

Target

CXCL8

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

13.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

9E3C-X-C motif chemokine EF-4Chemokine (C-X-C motif) ligand 8Embryo fibroblast protein 1; EMF-1

Species

Chicken (Gallus)

Protein Name

Recombinant Protein

AA Sequence

ALSQGRTLVKMGNELRCQCISTHSKFIHPKSIQDVKLTPSGPHCKNVEIIATLKDGREVCLDPTAPWVQLIVKALMAKAQLNSDAP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Centruroides limbatus Potassium channel toxin alpha-KTx 1.9
MBS1040306-01 0.02 mg (E-Coli)

Recombinant Centruroides limbatus Potassium channel toxin alpha-KTx 1.9

Sign In for Pricing
View Details
Recombinant Centruroides limbatus Potassium channel toxin alpha-KTx 1.9
MBS1040306-02 0.1 mg (E-Coli)

Recombinant Centruroides limbatus Potassium channel toxin alpha-KTx 1.9

Sign In for Pricing
View Details
Recombinant Centruroides limbatus Potassium channel toxin alpha-KTx 1.9
MBS1040306-03 0.02 mg (Yeast)

Recombinant Centruroides limbatus Potassium channel toxin alpha-KTx 1.9

Sign In for Pricing
View Details
Recombinant Centruroides limbatus Potassium channel toxin alpha-KTx 1.9
MBS1040306-04 0.1 mg (Yeast)

Recombinant Centruroides limbatus Potassium channel toxin alpha-KTx 1.9

Sign In for Pricing
View Details
Recombinant Centruroides limbatus Potassium channel toxin alpha-KTx 1.9
MBS1040306-05 0.02 mg (Baculovirus)

Recombinant Centruroides limbatus Potassium channel toxin alpha-KTx 1.9

Sign In for Pricing
View Details
Recombinant Centruroides limbatus Potassium channel toxin alpha-KTx 1.9
MBS1040306-06 1 mg (E-Coli)

Recombinant Centruroides limbatus Potassium channel toxin alpha-KTx 1.9

Sign In for Pricing
View Details