Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-8 (CXCL8), partial

Recombinant Human Interleukin-8 (CXCL8), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: CXCL8. Target Synonyms: C-X-C motif chemokine hemokine (C-X-C motif) ligand 8Emoctakin; Granulocyte chemotactic protein 1; GCP-1Monocyte-derived neutrophil chemotactic factor; MDNCFMonocyte-derived neutrophil-activating peptide; MONAPNeutrophil-activating protein 1; NAP-1; Protein 3-10CT-cell chemotactic factor. Accession Number: P10145. Expression Region: 23~99aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 13.0kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Interleukin-8 (CXCL8), partial is a purified Recombinant Protein.

Accession Number

P10145

Expression Region

23~99aa

Host

E. coli

Target

CXCL8

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Field of Research

Immunology

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

13.0kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

C-X-C motif chemokine hemokine (C-X-C motif) ligand 8Emoctakin; Granulocyte chemotactic protein 1; GCP-1Monocyte-derived neutrophil chemotactic factor; MDNCFMonocyte-derived neutrophil-activating peptide; MONAPNeutrophil-activating protein 1; NAP-1; Protein 3-10CT-cell chemotactic factor

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

AVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Firefly Luciferase pAb
PA11683-01 50 μL

Rabbit Anti-Firefly Luciferase pAb

Sign In for Pricing
View Details
Rabbit Anti-Firefly Luciferase pAb
PA11683-02 100 μL

Rabbit Anti-Firefly Luciferase pAb

Sign In for Pricing
View Details
Timp4 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K3524804 1.0 µg DNA

Timp4 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
α, ω-Bis-Mercapto PEG
1120000-40.1G 1 g

α, ω-Bis-Mercapto PEG

Sign In for Pricing
View Details
PE-Cy5 anti-mouse CD86
FC0947 100 Tests

PE-Cy5 anti-mouse CD86

Sign In for Pricing
View Details
ABCA7 shRNA Plasmid (m)
sc-45432-SH 20 µg

ABCA7 shRNA Plasmid (m)

Sign In for Pricing
View Details