Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human ADP-ribosylation factor-like protein 2-binding protein (ARL2BP)

Recombinant Human ADP-ribosylation factor-like protein 2-binding protein (ARL2BP) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: ARL2BP. Target Synonyms: Binder of ARF2 protein 1. Accession Number: Q9Y2Y0. Expression Region: 1~163aa. Tag Info: N-Terminal Gst-Tagged. Theoretical MW: 45.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human ADP-ribosylation factor-like protein 2-binding protein (ARL2BP) is a purified Recombinant Protein.

Accession Number

Q9Y2Y0

Expression Region

1~163aa

Host

E. coli

Target

ARL2BP

Conjugation

Unconjugated

Tag

N-Terminal Gst-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

45.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Binder of ARF2 protein 1

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MDALEGESFALSFSSASDAEFDAVVGYLEDIIMDDEFQLLQRNFMDKYYLEFEDTEENKLIYTPIFNEYISLVEKYIEEQLLQRIPEFNMAAFTTTLQHHKDEVAGDIFDMLLTFTDFLAFKEMFLDYRAEKEGRGLDLSSGLVVTSLCKSSSLPASQNNLRH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-IL17/IL17A Antibody Picoband®, Cy3 Conjugate
RP1019-Cy3 100 µg/Vial

Anti-IL17/IL17A Antibody Picoband®, Cy3 Conjugate

Sign In for Pricing
View Details
SCG2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K2099605 3x 1.0 µg

SCG2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Human Soluble fibrin monomer complex (SFMC) ELISA Kit
AE63070HU-01 48 Tests

Human Soluble fibrin monomer complex (SFMC) ELISA Kit

Sign In for Pricing
View Details
Human Soluble fibrin monomer complex (SFMC) ELISA Kit
AE63070HU-02 96 Tests

Human Soluble fibrin monomer complex (SFMC) ELISA Kit

Sign In for Pricing
View Details
PRIM1 AAV Vector (Human) (CMV)
37616101 1 µg

PRIM1 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Rat Monoclonal ADAM10 Antibody (139712) [PE/Cy7]
FAB946PECY7 0.1 mL

Rat Monoclonal ADAM10 Antibody (139712) [PE/Cy7]

Sign In for Pricing
View Details