Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human metapneumovirus Matrix protein (M)

Recombinant Human metapneumovirus Matrix protein (M) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human metapneumovirus (strain CAN97-83) (HMPV) . Target Name: M. Target Synonyms: M; Matrix protein. Accession Number: Q6WB99. Expression Region: 1~254aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 35.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human metapneumovirus Matrix protein (M) is a purified Recombinant Protein.

Accession Number

Q6WB99

Expression Region

1~254aa

Host

E. coli

Target

M

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

35.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

M; Matrix protein

Species

Human metapneumovirus (strain CAN97-83) (HMPV)

Protein Name

Recombinant Protein

AA Sequence

MESYLVDTYQGIPYTAAVQVDLVEKDLLPASLTIWFPLFQANTPPAVLLDQLKTLTITTLYAASQSGPILKVNASAQGAAMSVLPKKFEVNATVALDEYSKLEFDKLTVCEVKTVYLTTMKPYGMVSKFVSSAKPVGKKTHDLIALCDFMDLEKNTPVTIPAFIKSVSIKESESATVEAAISSEADQALTQAKIAPYAGLIMIMTMNNPKGIFKKLGAGTQVIVELGAYVQAESISKICKTWSHQGTRYVLKSR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C4orf28 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-15189R-BF680 100 µL

C4orf28 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
Tenascin C Antibody
orb44503 0.1 mg

Tenascin C Antibody

Sign In for Pricing
View Details
CD20 Antibody [B-Ly1] (PE-Cy5)
99-368 100 Tests

CD20 Antibody [B-Ly1] (PE-Cy5)

Sign In for Pricing
View Details
Zfp839 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4676707 1.0 µg DNA

Zfp839 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
WNK2 (WNK Lysine deficient Protein Kinase 2, KIAA1760, NY-CO-43, P/OKcl.13, PRKWNK2, SDCCAG43) (PE)
253458-PE 100 µL

WNK2 (WNK Lysine deficient Protein Kinase 2, KIAA1760, NY-CO-43, P/OKcl.13, PRKWNK2, SDCCAG43) (PE)

Sign In for Pricing
View Details
EphB3 Protein Lysate (Human) with C-Ha Tag
19364031 100 µg

EphB3 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details