Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human metapneumovirus Matrix protein (M)

Recombinant Human metapneumovirus Matrix protein (M) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human metapneumovirus (strain CAN97-83) (HMPV) . Target Name: M. Target Synonyms: M; Matrix protein. Accession Number: Q6WB99. Expression Region: 1~254aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 35.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human metapneumovirus Matrix protein (M) is a purified Recombinant Protein.

Accession Number

Q6WB99

Expression Region

1~254aa

Host

E. coli

Target

M

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

35.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

M; Matrix protein

Species

Human metapneumovirus (strain CAN97-83) (HMPV)

Protein Name

Recombinant Protein

AA Sequence

MESYLVDTYQGIPYTAAVQVDLVEKDLLPASLTIWFPLFQANTPPAVLLDQLKTLTITTLYAASQSGPILKVNASAQGAAMSVLPKKFEVNATVALDEYSKLEFDKLTVCEVKTVYLTTMKPYGMVSKFVSSAKPVGKKTHDLIALCDFMDLEKNTPVTIPAFIKSVSIKESESATVEAAISSEADQALTQAKIAPYAGLIMIMTMNNPKGIFKKLGAGTQVIVELGAYVQAESISKICKTWSHQGTRYVLKSR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-HBQ1 Antibody Picoband® (Dylight488 Conjugate)
A14380-1-Dylight488 100 µg

Anti-HBQ1 Antibody Picoband® (Dylight488 Conjugate)

Sign In for Pricing
View Details
Anti-TREX1 Antibody Picoband® (Dylight594 Conjugate)
PB9748-Dylight594 100 µg

Anti-TREX1 Antibody Picoband® (Dylight594 Conjugate)

Sign In for Pricing
View Details
Nogo B Receptor monoclonal antibody
orb1723794-01 50 µL

Nogo B Receptor monoclonal antibody

Sign In for Pricing
View Details
Nogo B Receptor monoclonal antibody
orb1723794-02 100 µL

Nogo B Receptor monoclonal antibody

Sign In for Pricing
View Details
MRPL22 Polyclonal Antibody, HRP Conjugated
A59861-050 50 µL

MRPL22 Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
Mrgpra2b 3'UTR GFP Stable Cell Line
TU163388 1.0 mL

Mrgpra2b 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details