Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Anionic trypsin-1 (Prss1)

Recombinant Rat Anionic trypsin-1 (Prss1) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Rat (Rattus norvegicus) . Target Name: Prss1. Target Synonyms: Anionic trypsin I (Pretrypsinogen I; Serine protease 1; Try1) . Accession Number: P00762. Expression Region: 24~246aa. Tag Info: N-Terminal 10Xhis-Tagged. Theoretical MW: 27.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Rat Anionic trypsin-1 (Prss1) is a purified Recombinant Protein.

Accession Number

P00762

Expression Region

24~246aa

Host

E. coli

Target

Prss1

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged

Field of Research

Metabolism

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

27.2kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Anionic trypsin I (Pretrypsinogen I; Serine protease 1; Try1)

Species

Rat (Rattus norvegicus)

Protein Name

Recombinant Protein

AA Sequence

IVGGYTCPEHSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGDEQFINAAKIIKHPNYSSWTLNNDIMLIKLSSPVKLNARVAPVALPSACAPAGTQCLISGWGNTLSNGVNNPDLLQCVDAPVLSQADCEAAYPGEITSSMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCALPDNPGVYTKVCNFVGWIQDTIAAN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anserini α-SYN ELISA Kit
EAS0040 96 Tests

Anserini α-SYN ELISA Kit

Sign In for Pricing
View Details
Phospho-Ack1 (Tyr284) Polyclonal Antibody, APC-Cy7 Conjugated
bs-3045R-APC-Cy7 100 µL

Phospho-Ack1 (Tyr284) Polyclonal Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details
ING1 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-1291R-BF594 100 µL

ING1 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
ARHGEF5 Protein Lysate (Human) with C-Ha Tag
12343031 100 µg

ARHGEF5 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Phospho-c-Abl (Thr754 + Thr735) Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
bs-10356R-BF555 100 µL

Phospho-c-Abl (Thr754 + Thr735) Polyclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
MRP-L49 Rabbit Polyclonal Antibody
E28PT2868 100 µL

MRP-L49 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details