Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Anionic trypsin-1 (Prss1)

Recombinant Rat Anionic trypsin-1 (Prss1) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Rat (Rattus norvegicus) . Target Name: Prss1. Target Synonyms: Anionic trypsin I (Pretrypsinogen I; Serine protease 1; Try1) . Accession Number: P00762. Expression Region: 24~246aa. Tag Info: N-Terminal 10Xhis-Tagged. Theoretical MW: 27.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Rat Anionic trypsin-1 (Prss1) is a purified Recombinant Protein.

Accession Number

P00762

Expression Region

24~246aa

Host

E. coli

Target

Prss1

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged

Field of Research

Metabolism

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

27.2kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Anionic trypsin I (Pretrypsinogen I; Serine protease 1; Try1)

Species

Rat (Rattus norvegicus)

Protein Name

Recombinant Protein

AA Sequence

IVGGYTCPEHSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGDEQFINAAKIIKHPNYSSWTLNNDIMLIKLSSPVKLNARVAPVALPSACAPAGTQCLISGWGNTLSNGVNNPDLLQCVDAPVLSQADCEAAYPGEITSSMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCALPDNPGVYTKVCNFVGWIQDTIAAN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HMGA2 Human shRNA Lentiviral Particle (Locus ID 8091)
TL319507V 500 µL Each

HMGA2 Human shRNA Lentiviral Particle (Locus ID 8091)

Sign In for Pricing
View Details
MDH2 (Malate Dehydrogenase 2, NAD (Mitochondrial), M-MDH, MDH, MGC:3559, MOR1) (MaxLight 405) discontinued
248606-ML405 100 µL

MDH2 (Malate Dehydrogenase 2, NAD (Mitochondrial), M-MDH, MDH, MGC:3559, MOR1) (MaxLight 405) discontinued

Sign In for Pricing
View Details
4-Fluorobenzene-1,3-dicarboxylic acid
HY-41671 100 mg

4-Fluorobenzene-1,3-dicarboxylic acid

Sign In for Pricing
View Details
Recombinant Human GOLPH3 Protein, N-His
HP263012-01 50 µg

Recombinant Human GOLPH3 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human GOLPH3 Protein, N-His
HP263012-02 100 µg

Recombinant Human GOLPH3 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human GOLPH3 Protein, N-His
HP263012-03 1 mg

Recombinant Human GOLPH3 Protein, N-His

Sign In for Pricing
View Details