Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MIP-5/CCL15, Human

MIP-5/CCL15 Protein, Human is a CC chemokine with strong chemotactic properties towards myeloid cells such as dendritic cells, monocytes, neutrophils and some T-lymphocytes. MIP-5/CCL15 Protein, Human binds to chemokine receptors CCR1 and CCR3 and plays a key role in leukocyte recruitment and inflammatory disease development. development. MIP-5/CCL15 Protein, Human is a recombinant human MIP-5/CCL15 (Q22-I113) expressed by E. coli[1].

Product Specifications

Product Name Alternative

MIP-5/CCL15 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mip-5-ccl15-protein-human.html

Purity

97.0

Smiles

QFINDAETELMMSKLPLENPVVLNSFHFAADCCTSYISQSIPCSLMKSYFETSSECSKPGVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI

Molecular Formula

6359 (Gene_ID) Q16663 (Q22-I113) (Accession)

Molecular Weight

Approximately 10-14 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Yasuo Shimizu, et al. CC-chemokine CCL15 expression and possible implications for the pathogenesis of IgE-related severe asthma. Mediators Inflamm. 2012;2012:475253.|[2]Ji-Sook Lee, et al. Leukotactin-1/CCL15 induces cell migration and differentiation of human eosinophilic leukemia EoL-1 cells through PKCdelta activation. Mol Biol Rep. 2010 Jun;37 (5) :2149-56.|[3]Feng-Jiao Huang, et al. Follicular thyroid carcinoma but not adenoma recruits tumor-associated macrophages by releasing CCL15. BMC Cancer. 2016 Feb 15;16:98.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

BRG1 Mouse mAb
MBS9525385-01 0.04 mL

BRG1 Mouse mAb

Ask
View Details
BRG1 Mouse mAb
MBS9525385-02 0.1 mL

BRG1 Mouse mAb

Ask
View Details
BRG1 Mouse mAb
MBS9525385-03 0.2 mL

BRG1 Mouse mAb

Ask
View Details
BRG1 Mouse mAb
MBS9525385-04 5x 0.2 mL

BRG1 Mouse mAb

Ask
View Details
Cardiotrophin 1 (CTF1) Antibody
abx101142-01 100 µL

Cardiotrophin 1 (CTF1) Antibody

Ask
View Details
Cardiotrophin 1 (CTF1) Antibody
abx101142-02 200 µL

Cardiotrophin 1 (CTF1) Antibody

Ask
View Details