Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Subtilosin-A (sboA)

Recombinant Bacillus subtilis Subtilosin-A (sboA) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Bacillus subtilis (strain 168) . Target Name: sboA. Target Synonyms: Antilisterial bacteriocin subtilosin (sbo) . Accession Number: O07623. Expression Region: 9~43aa. Tag Info: N-Terminal 6Xhis-Ksi-Tagged. Theoretical MW: 18.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Bacillus subtilis Subtilosin-A (sboA) is a purified Recombinant Protein.

Accession Number

O07623

Expression Region

9~43aa

Host

E. coli

Target

SboA

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Ksi-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

18.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Antilisterial bacteriocin subtilosin (sbo)

Species

Bacillus subtilis (strain 168)

Protein Name

Recombinant Protein

AA Sequence

NKGCATCSIGAACLVDGPIPDFEIAGATGLFGLWG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HLA DMB (HLA-DMB) (NM_002118) Human Over-expression Lysate
LS003109-100ug 100 µg

HLA DMB (HLA-DMB) (NM_002118) Human Over-expression Lysate

Sign In for Pricing
View Details
Exendin 4
hor-269 20µg

Exendin 4

Sign In for Pricing
View Details
USP20/VDU2 Antibody
orb1534813 50 µg

USP20/VDU2 Antibody

Sign In for Pricing
View Details
Dntt (NM_001043228) Mouse Tagged Lenti ORF Clone
MR221098L4 10 µg

Dntt (NM_001043228) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Gamma Catenin Recombinant Antibody, PE-Cy7 Conjugated
bsm-61391R-PE-Cy7-01 20 µL

Gamma Catenin Recombinant Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details
Gamma Catenin Recombinant Antibody, PE-Cy7 Conjugated
bsm-61391R-PE-Cy7-02 100 µL

Gamma Catenin Recombinant Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details