Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Subtilosin-A (sboA)

Recombinant Bacillus subtilis Subtilosin-A (sboA) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Bacillus subtilis (strain 168) . Target Name: sboA. Target Synonyms: Antilisterial bacteriocin subtilosin (sbo) . Accession Number: O07623. Expression Region: 9~43aa. Tag Info: N-Terminal 6Xhis-Ksi-Tagged. Theoretical MW: 18.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Bacillus subtilis Subtilosin-A (sboA) is a purified Recombinant Protein.

Accession Number

O07623

Expression Region

9~43aa

Host

E. coli

Target

SboA

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Ksi-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

18.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Antilisterial bacteriocin subtilosin (sbo)

Species

Bacillus subtilis (strain 168)

Protein Name

Recombinant Protein

AA Sequence

NKGCATCSIGAACLVDGPIPDFEIAGATGLFGLWG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Ceramide synthase 1,Cers1 ELISA KIT
JOT-EK6943Hu 96 wells

Human Ceramide synthase 1,Cers1 ELISA KIT

Sign In for Pricing
View Details
CLMN Adenovirus (Rat)
16358056 1.0 mL

CLMN Adenovirus (Rat)

Sign In for Pricing
View Details
Anti-NDUFB7 antibody
STJ115648 100 µl

Anti-NDUFB7 antibody

Sign In for Pricing
View Details
Cytokeratin 5 Recombinant Antibody, APC-Cy7 Conjugated
bsm-52063R-APC-Cy7 100 µL

Cytokeratin 5 Recombinant Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details
Dog/Canine Coxsackie Virus IgG ELISA Kit
BG-CAN10451 1 Each

Dog/Canine Coxsackie Virus IgG ELISA Kit

Sign In for Pricing
View Details
PTPN4 Protein Vector (Mouse) (pPM-C-His)
PV220909 500 ng

PTPN4 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details