Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus mRNA interferase MazF (mazF)

Recombinant Staphylococcus aureus mRNA interferase MazF (mazF) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Staphylococcus aureus (strain MW2) . Target Name: mazF. Target Synonyms: Toxin MazF (mRNA interferase MazF) . Accession Number: Q7A0D7. Expression Region: 1~120aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 17.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Staphylococcus aureus mRNA interferase MazF (mazF) is a purified Recombinant Protein.

Accession Number

Q7A0D7

Expression Region

1~120aa

Host

E. coli

Target

MazF

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

17.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Toxin MazF (mRNA interferase MazF)

Species

Staphylococcus aureus (strain MW2)

Protein Name

Recombinant Protein

AA Sequence

MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIRTLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PBP Recombinant Rabbit Monoclonal Antibody [SC58-09]
ET1610-18 100 µL

PBP Recombinant Rabbit Monoclonal Antibody [SC58-09]

Sign In for Pricing
View Details
Brivaracetam-d7 (Mixture of Diastereomers)
TRC-B677648-1MG 1 mg

Brivaracetam-d7 (Mixture of Diastereomers)

Sign In for Pricing
View Details
Recombinant Human MMP-2 Protein
PKSH031888-01 20 µg

Recombinant Human MMP-2 Protein

Sign In for Pricing
View Details
Recombinant Human MMP-2 Protein
PKSH031888-02 100 µg

Recombinant Human MMP-2 Protein

Sign In for Pricing
View Details
Tissue FFPE Sections, Lymphoid tissue
CS804924 5x 5 µm

Tissue FFPE Sections, Lymphoid tissue

Sign In for Pricing
View Details
AKT3 Mouse Monoclonal Antibody [Clone ID: 9A5.H9.G7]
TA396818S 25 µL

AKT3 Mouse Monoclonal Antibody [Clone ID: 9A5.H9.G7]

Sign In for Pricing
View Details