Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant E. coli Uncharacterized protein yjbL (yjbL)

Recombinant E. coli Uncharacterized protein yjbL (yjbL) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: E. coli (strain K12) . Target Name: yjbL. Target Synonyms: yjbL; b4047; JW4007; Uncharacterized protein YjbL. Accession Number: P32693. Expression Region: 1~84aa. Tag Info: N-Terminal 6Xhis-Ksi-Tagged. Theoretical MW: 25.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant E. coli Uncharacterized protein yjbL (yjbL) is a purified Recombinant Protein.

Accession Number

P32693

Expression Region

1~84aa

Host

E. coli

Target

YjbL

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Ksi-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

25.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

YjbL; b4047; JW4007; Uncharacterized protein YjbL

Species

E. coli (strain K12)

Protein Name

Recombinant Protein

AA Sequence

MLKIIPGATGYFNKTLNSNQFDNEDAIKDKLDNRGSIKGKLNNIYGKSIDYAALRHRDIIIAKIDLFIQRITHNLWHARKKMCF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Trelagliptin Succinate (SYR-472) 25mg
A13312-25 25 mg

Trelagliptin Succinate (SYR-472) 25mg

Sign In for Pricing
View Details
Mouse Anti-human CD2/PE-Cy7 antibody
SLM-30002M-PE-Cy7-01 25 Tests

Mouse Anti-human CD2/PE-Cy7 antibody

Sign In for Pricing
View Details
Mouse Anti-human CD2/PE-Cy7 antibody
SLM-30002M-PE-Cy7-02 50 Tests

Mouse Anti-human CD2/PE-Cy7 antibody

Sign In for Pricing
View Details
Mouse Anti-human CD2/PE-Cy7 antibody
SLM-30002M-PE-Cy7-03 100 Tests - Cy7

Mouse Anti-human CD2/PE-Cy7 antibody

Sign In for Pricing
View Details
Anti-Dystrophin/DMD Antibody Picoband® (HRP Conjugate)
PB9276-HRP 100 µg/Vial

Anti-Dystrophin/DMD Antibody Picoband® (HRP Conjugate)

Sign In for Pricing
View Details
COMT Antibody - middle region : FITC (ARP44327_P050-FITC)
ARP44327_P050-FITC 100 µL

COMT Antibody - middle region : FITC (ARP44327_P050-FITC)

Sign In for Pricing
View Details