Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharomyces cerevisiae Heat shock protein SSA1 (SSA1), partial

Recombinant Saccharomyces cerevisiae Heat shock protein SSA1 (SSA1), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) . Target Name: SSA1. Target Synonyms: Heat shock protein YG100. Accession Number: P10591. Expression Region: 443~642aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 28.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Saccharomyces cerevisiae Heat shock protein SSA1 (SSA1), partial is a purified Recombinant Protein.

Accession Number

P10591

Expression Region

443~642aa

Host

E. coli

Target

SSA1

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Field of Research

Cancer

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

28.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Heat shock protein YG100

Species

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Protein Name

Recombinant Protein

AA Sequence

ERAKTKDNNLLGKFELSGIPPAPRGVPQIEVTFDVDSNGILNVSAVEKGTGKSNKITITNDKGRLSKEDIEKMVAEAEKFKEEDEKESQRIASKNQLESIAYSLKNTISEAGDKLEQADKDTVTKKAEETISWLDSNTTASKEEFDDKLKELQDIANPIMSKLYQAGGAPGGAAGGAPGGFPGGAPPAPEAEGPTVEEVD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

WNT6 Adenovirus (Human)
50456051 1.0 mL

WNT6 Adenovirus (Human)

Sign In for Pricing
View Details
Recombinant Marchantia polymorpha Uncharacterized mitochondrial protein ymf13 (YMF13)
MBS1244632-01 0.02 mg (E-Coli)

Recombinant Marchantia polymorpha Uncharacterized mitochondrial protein ymf13 (YMF13)

Sign In for Pricing
View Details
Recombinant Marchantia polymorpha Uncharacterized mitochondrial protein ymf13 (YMF13)
MBS1244632-02 0.1 mg (E-Coli)

Recombinant Marchantia polymorpha Uncharacterized mitochondrial protein ymf13 (YMF13)

Sign In for Pricing
View Details
Recombinant Marchantia polymorpha Uncharacterized mitochondrial protein ymf13 (YMF13)
MBS1244632-03 0.02 mg (Yeast)

Recombinant Marchantia polymorpha Uncharacterized mitochondrial protein ymf13 (YMF13)

Sign In for Pricing
View Details
Recombinant Marchantia polymorpha Uncharacterized mitochondrial protein ymf13 (YMF13)
MBS1244632-04 0.1 mg (Yeast)

Recombinant Marchantia polymorpha Uncharacterized mitochondrial protein ymf13 (YMF13)

Sign In for Pricing
View Details
Recombinant Marchantia polymorpha Uncharacterized mitochondrial protein ymf13 (YMF13)
MBS1244632-05 0.02 mg (Baculovirus)

Recombinant Marchantia polymorpha Uncharacterized mitochondrial protein ymf13 (YMF13)

Sign In for Pricing
View Details