Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human RNA-binding motif protein, X chromosome (RBMX), partial

Recombinant Human RNA-binding motif protein, X chromosome (RBMX), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: RBMX. Target Synonyms: Glycoprotein p43 (Heterogeneous nuclear ribonucleoprotein G; hnRNP G; HNRPG; RBMXP1) . Accession Number: P38159. Expression Region: 333~391aa. Tag Info: N-Terminal Gst-Tagged. Theoretical MW: 33.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human RNA-binding motif protein, X chromosome (RBMX), partial is a purified Recombinant Protein.

Accession Number

P38159

Expression Region

333~391aa

Host

E. coli

Target

RBMX

Conjugation

Unconjugated

Tag

N-Terminal Gst-Tagged

Field of Research

Epigenetics, Nuclear Signaling

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

33.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Glycoprotein p43 (Heterogeneous nuclear ribonucleoprotein G; hnRNP G; HNRPG; RBMXP1)

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

DLYSSGRDRVGRQERGLPPSMERGYPPPRDSYSSSSRGAPRGGGRGGSRSDRGGGRSRY

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lymphocyte Separating Medium, Pancoll human, Density: 1.077 g/ mL
P04-60125M 2x 50 mL

Lymphocyte Separating Medium, Pancoll human, Density: 1.077 g/ mL

Sign In for Pricing
View Details
Rabbit Polyclonal FAM120A Antibody [DyLight 550]
NBP1-77367R 0.1 mL

Rabbit Polyclonal FAM120A Antibody [DyLight 550]

Sign In for Pricing
View Details
Nori® Equine Visfatin ELISA Kit-2 Plates
GR106613-2 2x 96 Well

Nori® Equine Visfatin ELISA Kit-2 Plates

Sign In for Pricing
View Details
(S)-(-)-1,1-Bi-(2-naphthol)
RM7901-5G 1 unit

(S)-(-)-1,1-Bi-(2-naphthol)

Sign In for Pricing
View Details
Breast Cancer Resistance Protein (BCRP, BCRP1, ABC15, ABCP, ATP-binding Cassette Sub-family G Member 2, ABCG2, BMDP, CD338, CDw338, EST157481, MGC102821, Mitoxantrone Resistance-associated Protein, MRX, MXR, MXR1, Placenta-specific ATP-binding Cassette Transporter)
B2738-01B 1 mL

Breast Cancer Resistance Protein (BCRP, BCRP1, ABC15, ABCP, ATP-binding Cassette Sub-family G Member 2, ABCG2, BMDP, CD338, CDw338, EST157481, MGC102821, Mitoxantrone Resistance-associated Protein, MRX, MXR, MXR1, Placenta-specific ATP-binding Cassette Transporter)

Sign In for Pricing
View Details
CPSF3L, NT (CPSF3L, INTS11, RC68, Integrator complex subunit 11, Cleavage and polyadenylation-specific factor 3-like protein, Protein related to CPSF subunits of 68kD) (FITC) discontinued
034179-FITC 200 µL

CPSF3L, NT (CPSF3L, INTS11, RC68, Integrator complex subunit 11, Cleavage and polyadenylation-specific factor 3-like protein, Protein related to CPSF subunits of 68kD) (FITC) discontinued

Sign In for Pricing
View Details