Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human RNA-binding motif protein, X chromosome (RBMX), partial

Recombinant Human RNA-binding motif protein, X chromosome (RBMX), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: RBMX. Target Synonyms: Glycoprotein p43 (Heterogeneous nuclear ribonucleoprotein G; hnRNP G; HNRPG; RBMXP1) . Accession Number: P38159. Expression Region: 333~391aa. Tag Info: N-Terminal Gst-Tagged. Theoretical MW: 33.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human RNA-binding motif protein, X chromosome (RBMX), partial is a purified Recombinant Protein.

Accession Number

P38159

Expression Region

333~391aa

Host

E. coli

Target

RBMX

Conjugation

Unconjugated

Tag

N-Terminal Gst-Tagged

Field of Research

Epigenetics, Nuclear Signaling

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

33.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Glycoprotein p43 (Heterogeneous nuclear ribonucleoprotein G; hnRNP G; HNRPG; RBMXP1)

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

DLYSSGRDRVGRQERGLPPSMERGYPPPRDSYSSSSRGAPRGGGRGGSRSDRGGGRSRY

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL18P3 3'UTR GFP Stable Cell Line
TU070873 1.0 mL

RPL18P3 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
IFNG Antibody
A41943-100UG 100 µg

IFNG Antibody

Sign In for Pricing
View Details
Lentiviral human COCH shRNA (UAS) - Lentiviral human COCH shRNA (UAS, RFP) (100)
GTR15349083 1 Vial

Lentiviral human COCH shRNA (UAS) - Lentiviral human COCH shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
MAZ Antibody, HRP conjugated
A28253-50UG 50 µg

MAZ Antibody, HRP conjugated

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) VTE5 Polyclonal Antibody
MBS9011174 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) VTE5 Polyclonal Antibody

Sign In for Pricing
View Details
Reversible Tray Lid for PST/PSBT
WAS2032 1 Each

Reversible Tray Lid for PST/PSBT

Sign In for Pricing
View Details