Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human RNA-binding motif protein, X chromosome (RBMX), partial

Recombinant Human RNA-binding motif protein, X chromosome (RBMX), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: RBMX. Target Synonyms: Glycoprotein p43 (Heterogeneous nuclear ribonucleoprotein G; hnRNP G; HNRPG; RBMXP1) . Accession Number: P38159. Expression Region: 333~391aa. Tag Info: N-Terminal Gst-Tagged. Theoretical MW: 33.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human RNA-binding motif protein, X chromosome (RBMX), partial is a purified Recombinant Protein.

Accession Number

P38159

Expression Region

333~391aa

Host

E. coli

Target

RBMX

Conjugation

Unconjugated

Tag

N-Terminal Gst-Tagged

Field of Research

Epigenetics, Nuclear Signaling

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

33.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Glycoprotein p43 (Heterogeneous nuclear ribonucleoprotein G; hnRNP G; HNRPG; RBMXP1)

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

DLYSSGRDRVGRQERGLPPSMERGYPPPRDSYSSSSRGAPRGGGRGGSRSDRGGGRSRY

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GSG1 CytoSection
TS415105P5 25 Slides

GSG1 CytoSection

Sign In for Pricing
View Details
KDM6A (Lysine-specific Demethylase 6A, 11411-, Histone Demethylase UTX, Ubiquitously Transcribed TPR Protein on the X Chromosome, Ubiquitously Transcribed X Chromosome Tetratricopeptide Repeat Protein, Kdm6a, Utx) (APC) discontinued
302517-APC 200 µL

KDM6A (Lysine-specific Demethylase 6A, 11411-, Histone Demethylase UTX, Ubiquitously Transcribed TPR Protein on the X Chromosome, Ubiquitously Transcribed X Chromosome Tetratricopeptide Repeat Protein, Kdm6a, Utx) (APC) discontinued

Sign In for Pricing
View Details
NKp46, Natural Cytotoxicity Receptor (NCR NKp46, CD335, Lymphocyte Antigen 94, Ly94, Natural Cytotoxicity Triggering Receptor 1, NCR1, NCT1, Natural Killer Cell Activating Receptor NKp46, NK Cell Activating Receptor) (Biotin)
MBS6249203-01 0.1 mL

NKp46, Natural Cytotoxicity Receptor (NCR NKp46, CD335, Lymphocyte Antigen 94, Ly94, Natural Cytotoxicity Triggering Receptor 1, NCR1, NCT1, Natural Killer Cell Activating Receptor NKp46, NK Cell Activating Receptor) (Biotin)

Sign In for Pricing
View Details
NKp46, Natural Cytotoxicity Receptor (NCR NKp46, CD335, Lymphocyte Antigen 94, Ly94, Natural Cytotoxicity Triggering Receptor 1, NCR1, NCT1, Natural Killer Cell Activating Receptor NKp46, NK Cell Activating Receptor) (Biotin)
MBS6249203-02 5x 0.1 mL

NKp46, Natural Cytotoxicity Receptor (NCR NKp46, CD335, Lymphocyte Antigen 94, Ly94, Natural Cytotoxicity Triggering Receptor 1, NCR1, NCT1, Natural Killer Cell Activating Receptor NKp46, NK Cell Activating Receptor) (Biotin)

Sign In for Pricing
View Details
Recombinant Candida Albicans REX4 Protein (aa 1-285)
VAng-Lsx05860-50gEcoli 50 µg (E. coli)

Recombinant Candida Albicans REX4 Protein (aa 1-285)

Sign In for Pricing
View Details
Nfe2l1 ORF Vector (Mouse) (pORF)
ORF051297 1.0 µg DNA

Nfe2l1 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details