Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human RNA-binding motif protein, X chromosome (RBMX), partial

Recombinant Human RNA-binding motif protein, X chromosome (RBMX), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: RBMX. Target Synonyms: Glycoprotein p43 (Heterogeneous nuclear ribonucleoprotein G; hnRNP G; HNRPG; RBMXP1) . Accession Number: P38159. Expression Region: 333~391aa. Tag Info: N-Terminal Gst-Tagged. Theoretical MW: 33.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human RNA-binding motif protein, X chromosome (RBMX), partial is a purified Recombinant Protein.

Accession Number

P38159

Expression Region

333~391aa

Host

E. coli

Target

RBMX

Conjugation

Unconjugated

Tag

N-Terminal Gst-Tagged

Field of Research

Epigenetics, Nuclear Signaling

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

33.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Glycoprotein p43 (Heterogeneous nuclear ribonucleoprotein G; hnRNP G; HNRPG; RBMXP1)

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

DLYSSGRDRVGRQERGLPPSMERGYPPPRDSYSSSSRGAPRGGGRGGSRSDRGGGRSRY

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TIP49A (RUVBL1) (NM_003707) Human Mass Spec Standard
PH301170 10 µg

TIP49A (RUVBL1) (NM_003707) Human Mass Spec Standard

Sign In for Pricing
View Details
PRUNE, CT (PRUNE, Protein prune homolog, Drosophila-related expressed sequence 17, HTcD37) (MaxLight 405)
MBS6338023-01 0.1 mL

PRUNE, CT (PRUNE, Protein prune homolog, Drosophila-related expressed sequence 17, HTcD37) (MaxLight 405)

Sign In for Pricing
View Details
PRUNE, CT (PRUNE, Protein prune homolog, Drosophila-related expressed sequence 17, HTcD37) (MaxLight 405)
MBS6338023-02 5x 0.1 mL

PRUNE, CT (PRUNE, Protein prune homolog, Drosophila-related expressed sequence 17, HTcD37) (MaxLight 405)

Sign In for Pricing
View Details
MKP1 Antibody
MBS8504345-01 0.1 mg

MKP1 Antibody

Sign In for Pricing
View Details
MKP1 Antibody
MBS8504345-02 0.1 mL (AF405L)

MKP1 Antibody

Sign In for Pricing
View Details
MKP1 Antibody
MBS8504345-03 0.1 mL (AF405S)

MKP1 Antibody

Sign In for Pricing
View Details