Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human RNA-binding motif protein, X chromosome (RBMX), partial

Recombinant Human RNA-binding motif protein, X chromosome (RBMX), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: RBMX. Target Synonyms: Glycoprotein p43 (Heterogeneous nuclear ribonucleoprotein G; hnRNP G; HNRPG; RBMXP1) . Accession Number: P38159. Expression Region: 333~391aa. Tag Info: N-Terminal Gst-Tagged. Theoretical MW: 33.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human RNA-binding motif protein, X chromosome (RBMX), partial is a purified Recombinant Protein.

Accession Number

P38159

Expression Region

333~391aa

Host

E. coli

Target

RBMX

Conjugation

Unconjugated

Tag

N-Terminal Gst-Tagged

Field of Research

Epigenetics, Nuclear Signaling

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

33.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Glycoprotein p43 (Heterogeneous nuclear ribonucleoprotein G; hnRNP G; HNRPG; RBMXP1)

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

DLYSSGRDRVGRQERGLPPSMERGYPPPRDSYSSSSRGAPRGGGRGGSRSDRGGGRSRY

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Ras-related protein Rab-39A, RAB39 ELISA KIT
ELI-36039h 96 Tests

Human Ras-related protein Rab-39A, RAB39 ELISA KIT

Sign In for Pricing
View Details
Rabbit Polyclonal CLCN6 Antibody
NBP1-85583-25ul 25 µL

Rabbit Polyclonal CLCN6 Antibody

Sign In for Pricing
View Details
Human PIN4 Recombinant Protein
PPT-14571 100 µg

Human PIN4 Recombinant Protein

Sign In for Pricing
View Details
5,6-dihydro-1H-pyridin-2-one
6052-73-9 1 Each

5,6-dihydro-1H-pyridin-2-one

Sign In for Pricing
View Details
LIMS3, ID (LIMS3L, PINCH3, LIM and senescent cell antigen-like-containing domain protein 3, Particularly interesting new Cys-His protein 3) (FITC)
MBS6316188-01 0.2 mL

LIMS3, ID (LIMS3L, PINCH3, LIM and senescent cell antigen-like-containing domain protein 3, Particularly interesting new Cys-His protein 3) (FITC)

Sign In for Pricing
View Details
LIMS3, ID (LIMS3L, PINCH3, LIM and senescent cell antigen-like-containing domain protein 3, Particularly interesting new Cys-His protein 3) (FITC)
MBS6316188-02 5x 0.2 mL

LIMS3, ID (LIMS3L, PINCH3, LIM and senescent cell antigen-like-containing domain protein 3, Particularly interesting new Cys-His protein 3) (FITC)

Sign In for Pricing
View Details