Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human RNA-binding motif protein, X chromosome (RBMX), partial

Recombinant Human RNA-binding motif protein, X chromosome (RBMX), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: RBMX. Target Synonyms: Glycoprotein p43 (Heterogeneous nuclear ribonucleoprotein G; hnRNP G; HNRPG; RBMXP1) . Accession Number: P38159. Expression Region: 333~391aa. Tag Info: N-Terminal Gst-Tagged. Theoretical MW: 33.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human RNA-binding motif protein, X chromosome (RBMX), partial is a purified Recombinant Protein.

Accession Number

P38159

Expression Region

333~391aa

Host

E. coli

Target

RBMX

Conjugation

Unconjugated

Tag

N-Terminal Gst-Tagged

Field of Research

Epigenetics, Nuclear Signaling

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

33.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Glycoprotein p43 (Heterogeneous nuclear ribonucleoprotein G; hnRNP G; HNRPG; RBMXP1)

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

DLYSSGRDRVGRQERGLPPSMERGYPPPRDSYSSSSRGAPRGGGRGGSRSDRGGGRSRY

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal GRO2 Antibody (MM0214-11B27) [DyLight 350]
NBP2-12227UV 0.1 mL

Mouse Monoclonal GRO2 Antibody (MM0214-11B27) [DyLight 350]

Sign In for Pricing
View Details
Pter sgRNA CRISPR Lentivector set (Rat)
K6823301 3x 1.0 µg

Pter sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
Lentiviral human PIGN shRNA (UAS) - Lentiviral human PIGN shRNA (UAS, GFP) (100)
GTR15310104 1 Vial

Lentiviral human PIGN shRNA (UAS) - Lentiviral human PIGN shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
CYB561 Protein Vector (Mouse) (pPB-N-His)
PV169259 500 ng

CYB561 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Human Collagen Type XI Alpha 2 (COL11a2) ELISA Kit
EKU08449-01 48 Tests

Human Collagen Type XI Alpha 2 (COL11a2) ELISA Kit

Sign In for Pricing
View Details
Human Collagen Type XI Alpha 2 (COL11a2) ELISA Kit
EKU08449-02 96 Tests

Human Collagen Type XI Alpha 2 (COL11a2) ELISA Kit

Sign In for Pricing
View Details