Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Actin-like protein 8 (ACTL8)

Recombinant Human Actin-like protein 8 (ACTL8) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: ACTL8. Target Synonyms: Cancer/testis antigen 57 (CT57) . Accession Number: Q9H568. Expression Region: 1~366aa. Tag Info: N-Terminal 6Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 46.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Actin-like protein 8 (ACTL8) is a purified Recombinant Protein.

Accession Number

Q9H568

Expression Region

1~366aa

Host

E. coli

Target

ACTL8

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged And C-Terminal Myc-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

46.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Cancer/testis antigen 57 (CT57)

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MAARTVIIDHGSGFLKAGTAGWNEPQMVFPNIVNYLPCKENPGPSYARRRVSLGIDICHPDTFSYPIERGRILNWEGVQYLWSFVLENHRREQEVPPVIITETPLREPADRKKMLEILFELLHVPSVLLADQLQMSLYASGLLTGVVVDSGYGLTRVQPFHQGRPLPASGKTLEFAGQDLSAYLLKSLFKEDCDRRCLFQLETVAVTQMNKCYVPQNLGEALDFRERQQSALDESNTYQLPDGSRVELTPMQRVAPEMFFSPQVFEQPGPSIPRAIVESVESCEISLRPLLVSHVMACGGNTLYPGFTKRLFRELMGDHVSSTKATVWEGSNRNFSVWLGASVVAHLSTYQSEWMSREEYGEHMRM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tenofovir hydrate 5mg
A18042-5 5 mg

Tenofovir hydrate 5mg

Sign In for Pricing
View Details
Hyal1 Mouse shRNA Lentiviral Particle (Locus ID 15586)
TL513020V 500 µL Each

Hyal1 Mouse shRNA Lentiviral Particle (Locus ID 15586)

Sign In for Pricing
View Details
Cat Carbohydrate Sulfotransferase 15 (CHST15) ELISA Kit
MBS9901173 Inquire

Cat Carbohydrate Sulfotransferase 15 (CHST15) ELISA Kit

Sign In for Pricing
View Details
4- (Chloromethyl) -N-methyl-N- (2,2,2-trifluoroethyl) -1,3-thiazol-2-amine hydrochloride
WGC60183-01 50 mg

4- (Chloromethyl) -N-methyl-N- (2,2,2-trifluoroethyl) -1,3-thiazol-2-amine hydrochloride

Sign In for Pricing
View Details
4- (Chloromethyl) -N-methyl-N- (2,2,2-trifluoroethyl) -1,3-thiazol-2-amine hydrochloride
WGC60183-02 0.5 g

4- (Chloromethyl) -N-methyl-N- (2,2,2-trifluoroethyl) -1,3-thiazol-2-amine hydrochloride

Sign In for Pricing
View Details
TEX28 Double Nickase Plasmid (h)
sc-416781-NIC 20 µg

TEX28 Double Nickase Plasmid (h)

Sign In for Pricing
View Details