Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Actin-like protein 8 (ACTL8)

Recombinant Human Actin-like protein 8 (ACTL8) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: ACTL8. Target Synonyms: Cancer/testis antigen 57 (CT57) . Accession Number: Q9H568. Expression Region: 1~366aa. Tag Info: N-Terminal 6Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 46.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Actin-like protein 8 (ACTL8) is a purified Recombinant Protein.

Accession Number

Q9H568

Expression Region

1~366aa

Host

E. coli

Target

ACTL8

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged And C-Terminal Myc-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

46.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Cancer/testis antigen 57 (CT57)

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MAARTVIIDHGSGFLKAGTAGWNEPQMVFPNIVNYLPCKENPGPSYARRRVSLGIDICHPDTFSYPIERGRILNWEGVQYLWSFVLENHRREQEVPPVIITETPLREPADRKKMLEILFELLHVPSVLLADQLQMSLYASGLLTGVVVDSGYGLTRVQPFHQGRPLPASGKTLEFAGQDLSAYLLKSLFKEDCDRRCLFQLETVAVTQMNKCYVPQNLGEALDFRERQQSALDESNTYQLPDGSRVELTPMQRVAPEMFFSPQVFEQPGPSIPRAIVESVESCEISLRPLLVSHVMACGGNTLYPGFTKRLFRELMGDHVSSTKATVWEGSNRNFSVWLGASVVAHLSTYQSEWMSREEYGEHMRM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CPPED1 antibody - C-terminal region (ARP62268_P050)
ARP62268_P050 100 µL

CPPED1 antibody - C-terminal region (ARP62268_P050)

Sign In for Pricing
View Details
ZNF212 Peptide (AAP33602)
AAP33602-100UG 100 µg

ZNF212 Peptide (AAP33602)

Sign In for Pricing
View Details
Mouse Slc48a1 qPCR Primer Pair
QM34874S 200 Tests

Mouse Slc48a1 qPCR Primer Pair

Sign In for Pricing
View Details
Mucin-1 Mouse mAb, Cy3 conjugated
orb2865605 100 µL

Mucin-1 Mouse mAb, Cy3 conjugated

Sign In for Pricing
View Details
CRBN ligand-853
HY-W999684 1 Each

CRBN ligand-853

Sign In for Pricing
View Details
Myst2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K4083906 1.0 µg DNA

Myst2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details