Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Protein S100-A4 (S100a4)

Recombinant Rat Protein S100-A4 (S100a4) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Rat (Rattus norvegicus) . Target Name: S100a4. Target Synonyms: Metastasin (Nerve growth factor-induced protein 42A; P9K; Placental calcium-binding protein; S100 calcium-binding protein A4) . Accession Number: P05942. Expression Region: 2~101aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 18.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Rat Protein S100-A4 (S100a4) is a purified Recombinant Protein.

Accession Number

P05942

Expression Region

2~101aa

Host

E. coli

Target

S100a4

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Field of Research

Cardiovascular

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

18.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Metastasin (Nerve growth factor-induced protein 42A; P9K; Placental calcium-binding protein; S100 calcium-binding protein A4)

Species

Rat (Rattus norvegicus)

Protein Name

Recombinant Protein

AA Sequence

ARPLEEALDVIVSTFHKYSGNEGDKFKLNKTELKELLTRELPSFLGRRTDEAAFQKLMNNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGCPDKEPRKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LYG2 Human qPCR Primer Pair (NM_175735)
HP218634 200 Reactions

LYG2 Human qPCR Primer Pair (NM_175735)

Sign In for Pricing
View Details
Smarcd3 Mouse qPCR Template Standard (NM_025891)
MK204819 1 Kit

Smarcd3 Mouse qPCR Template Standard (NM_025891)

Sign In for Pricing
View Details
ELISA Kit For Angiomotin-like protein 2
E2296m 96 Tests

ELISA Kit For Angiomotin-like protein 2

Sign In for Pricing
View Details
Recombinant Human S100A11 protein
CD00979-01 10 µg

Recombinant Human S100A11 protein

Sign In for Pricing
View Details
Recombinant Human S100A11 protein
CD00979-02 50 µg

Recombinant Human S100A11 protein

Sign In for Pricing
View Details
Ruby Hot Start Master (2x)
orb1733717 100 mL

Ruby Hot Start Master (2x)

Sign In for Pricing
View Details