Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Vaccinia virus Truncated plaque-size/host range protein (PS/HR)

Recombinant Vaccinia virus Truncated plaque-size/host range protein (PS/HR) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Vaccinia virus (strain LC16m8) (VACV) . Target Name: PS/HR. Target Synonyms: Protein B5. Accession Number: P24284. Expression Region: 18~92aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 10.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Vaccinia virus Truncated plaque-size/host range protein (PS/HR) is a purified Recombinant Protein.

Accession Number

P24284

Expression Region

18~92aa

Host

Yeast

Target

PS/HR

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

10.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Protein B5

Species

Vaccinia virus (strain LC16m8) (VACV)

Protein Name

Recombinant Protein

AA Sequence

YSTCTVPTMNNAKLTSTETSFNDKQKVTFTCDQGYHSLDPNAVCETDKWKYENPCKKMCTVSDYVSELYDKPLYK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

E2F1 (S332) (Transcription Factor E2F1, E2F-1, Retinoblastoma Binding Protein 3, RBBP-3, PRB-binding Protein E2F-1, PBR3, Retinoblastoma-associated Protein 1, RBAP-1, RBBP3) (MaxLight 750) discontinued
E0010-02S-ML750 100 µL

E2F1 (S332) (Transcription Factor E2F1, E2F-1, Retinoblastoma Binding Protein 3, RBBP-3, PRB-binding Protein E2F-1, PBR3, Retinoblastoma-associated Protein 1, RBAP-1, RBBP3) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Olr677 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV634946 1.0 µg DNA

Olr677 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
Research Grade Anti-Human HLA-DR (IMMU-114)
HY465036-01 100 µg

Research Grade Anti-Human HLA-DR (IMMU-114)

Sign In for Pricing
View Details
Research Grade Anti-Human HLA-DR (IMMU-114)
HY465036-02 1 mg

Research Grade Anti-Human HLA-DR (IMMU-114)

Sign In for Pricing
View Details
CD316 Polyclonal Antibody
MBS2535728-01 0.02 mL

CD316 Polyclonal Antibody

Sign In for Pricing
View Details
CD316 Polyclonal Antibody
MBS2535728-02 0.06 mL

CD316 Polyclonal Antibody

Sign In for Pricing
View Details