Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Vaccinia virus Truncated plaque-size/host range protein (PS/HR)

Recombinant Vaccinia virus Truncated plaque-size/host range protein (PS/HR) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Vaccinia virus (strain LC16m8) (VACV) . Target Name: PS/HR. Target Synonyms: Protein B5. Accession Number: P24284. Expression Region: 18~92aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 10.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Vaccinia virus Truncated plaque-size/host range protein (PS/HR) is a purified Recombinant Protein.

Accession Number

P24284

Expression Region

18~92aa

Host

Yeast

Target

PS/HR

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

10.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Protein B5

Species

Vaccinia virus (strain LC16m8) (VACV)

Protein Name

Recombinant Protein

AA Sequence

YSTCTVPTMNNAKLTSTETSFNDKQKVTFTCDQGYHSLDPNAVCETDKWKYENPCKKMCTVSDYVSELYDKPLYK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Beta galactosidase Recombinant Antibody, Cy5.5 Conjugated
bsm-62323R-Cy5.5 100 µL

Beta galactosidase Recombinant Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
ZNF679 Rabbit Polyclonal Antibody
TA339855 100 µL

ZNF679 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MAO-A/MAO-B Inhibitor
B2919-25 25 mg

MAO-A/MAO-B Inhibitor

Sign In for Pricing
View Details
Goat Transforming Growth Factor Beta 1 (TGF-Beta1) ELISA Kit
SL0151Gt-01 48 Tests

Goat Transforming Growth Factor Beta 1 (TGF-Beta1) ELISA Kit

Sign In for Pricing
View Details
Goat Transforming Growth Factor Beta 1 (TGF-Beta1) ELISA Kit
SL0151Gt-02 96 Tests

Goat Transforming Growth Factor Beta 1 (TGF-Beta1) ELISA Kit

Sign In for Pricing
View Details
Sheep Prolyl-4-Hydroxylase Alpha Polypeptide II ELISA Kit
MBS054491-01 48 Well

Sheep Prolyl-4-Hydroxylase Alpha Polypeptide II ELISA Kit

Sign In for Pricing
View Details