Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Prostaglandin E synthase 3 (PTGES3)

Recombinant Human Prostaglandin E synthase 3 (PTGES3) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: PTGES3. Target Synonyms: Cytosolic prostaglandin E2 synthase (cPGES; Hsp90 co-chaperone; Progesterone receptor complex p23; Telomerase-binding protein p23) . Accession Number: Q15185. Expression Region: 1~160aa. Tag Info: N-Terminal 10Xhis-Tagged. Theoretical MW: 21.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Prostaglandin E synthase 3 (PTGES3) is a purified Recombinant Protein.

Accession Number

Q15185

Expression Region

1~160aa

Host

Yeast

Target

PTGES3

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged

Field of Research

Cancer

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

21.2kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Cytosolic prostaglandin E2 synthase (cPGES; Hsp90 co-chaperone; Progesterone receptor complex p23; Telomerase-binding protein p23)

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTDRSILCCLRKGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNFDRFSEMMNNMGGDEDVDLPEVDGADDDSQDSDDEKMPDLE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GIMAP2 (GTPase IMAP Family Member 2, Immunity-associated Protein 2, hIMAP2, IMAP2) (MaxLight 650)
MBS6222352-01 0.1 mL

GIMAP2 (GTPase IMAP Family Member 2, Immunity-associated Protein 2, hIMAP2, IMAP2) (MaxLight 650)

Sign In for Pricing
View Details
GIMAP2 (GTPase IMAP Family Member 2, Immunity-associated Protein 2, hIMAP2, IMAP2) (MaxLight 650)
MBS6222352-02 5x 0.1 mL

GIMAP2 (GTPase IMAP Family Member 2, Immunity-associated Protein 2, hIMAP2, IMAP2) (MaxLight 650)

Sign In for Pricing
View Details
FAM69B Protein Lysate (Rat) with C-HA Tag
20087036 100 µg

FAM69B Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
Mouse TCF-3/E2A MAb (Clone 826927)
MAB7650-SP 25 µg

Mouse TCF-3/E2A MAb (Clone 826927)

Sign In for Pricing
View Details
DNASE2B siRNA Oligos set (Human)
18433171 3x 5 nmol

DNASE2B siRNA Oligos set (Human)

Sign In for Pricing
View Details
CD55 Rabbit pAb (APR20481N)
APR20481N-01 50 µL

CD55 Rabbit pAb (APR20481N)

Sign In for Pricing
View Details